Identifiers and Description

Gene Model Identifier

TTHERM_01040840

Standard Name

JSL2 (JUB6-like 2)

Aliases

PreTt01799 | 207.m00043

Description

hypothetical protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.4%

TetraMine Data

TTHERM_01040840

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_12400.11.0004249259458435e-52hypothetical protein (274 aa)

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:27909245: Kataoka K, Mochizuki K (2017) Heterochromatin aggregation during DNA elimination in Tetrahymena is facilitated by a prion-like protein. Journal of cell science 130(2):480-489

Sequences

>TTHERM_01040840(coding)
ATGGATAATATTTTAAATAATAGTTAAAATTTTAATCAGATACTTTGCTAAAAGCATGAA
TTGCCATGCTTATATTTAAAAGCTGATAGTGATAACTCTGATCATATCTATGCTTGCTCT
AATTGTATTTATTCTTATAATAATTTTAGAAAATATCTTTCTTTGCAAGATATAAAAGAT
AAATTAGACAATACAGTCTTAATGAATTGGCCACTTTTAGATGAATACGAATTAACAAAA
CAAATATAGTTGTTTTCTTAGTATTAAGGAGATTAAAAGTCAATTTAAAAAAATATTACT
AAGTTTTTTGAAGATTTATAAAATGAAATAGAACAAGCATTACAAAAATAAAAGAAGAAT
ATGTTAATCTATGCAGACACCATTTCCGAAAATACAAACTAGTTATTTGATTATTATCGA
GAAATAGCTTAATTTGATGCTCTAAAAAATATTATTGATTCAAATACATAAAAATAATAA
AAAGCTGATCAAATTTTATAAATATTTAAGATAAACAAATCGAATTAAGAAAAGTATAAA
AATAAAATTAAATAAGAATTATCTCAATTAAATTAATATTAAACCATTGATTTAAATGCA
CTGAAATATTTTAAAAATTCTATTTTATCCTAAATCGAGCTAATTGATTAAAATGAAAAT
TTAGATACTCTTCTCAGCCTTATAGCAAACAAAACTAACAATTGTAATGAAAGTTATCTT
AAATCTGTTTAGTCTGAACTACTAAAAATTTAAGATTTAATAAATAACTTAAATATTGAC
AAGGATGTTTTTTTGTAAGGGAAGAAATAAATTCAAATAGAAAAATTAAGCTAAGATCAA
ATTGAATGCATAGAAACACTTGTAAACAAAACTGTAGATCTAAATGAATAATACTAATAA
TTGAAAGAAGAAAAAGATAATAATATGATCATCTCTTCAAAATTACAACCTTCCTCCTAC
CTAATTTAAAATTAGTTATTCAAGCTAGATAATTTATTGACAAAATAGAAATTAGAAAAT
ATCTCTAAGCTACTGAGAAGCTATGATAATGAAGGCAACTAAAAATTTGAAATTGTTAAA
GGAGATTTTTTTATTTTTAACATGAAAATAAAATAGGATTGTTTGTATAGAATAGTTATT
AATCTTGAATTCAAAGATTCAAACAAATTTTTATTTATTGGTTTAGTTAGTAAATCTCAC
AAAGATTAGGTATATATTCATGATAAAAGCATTATTAATAGTTATACAATAAGTAATCAA
GGTGATCGTGGAGTTAGCAAAGTAATAAAAGGGAAATGCTTGAGAGATGTGAAATATCCA
GAAGAATATAATTAGATAGAAATAAGATTTTGTGTAAAAAATAAAATGTTCTAAGTGAGT
GATTATCCTAAAAGAGAAAATATTAATGAAATAAATGATGATAAGTTAAATTTAATAGAC
CTAAACTAAGAATATTATTTAGGATTTGAATTATATTATGACAAAGACTGTTTAACTATA
TTAGAGTGTGAAGAGCTATAATATTAAAATTGA


>TTHERM_01040840(protein)
MDNILNNSQNFNQILCQKHELPCLYLKADSDNSDHIYACSNCIYSYNNFRKYLSLQDIKD
KLDNTVLMNWPLLDEYELTKQIQLFSQYQGDQKSIQKNITKFFEDLQNEIEQALQKQKKN
MLIYADTISENTNQLFDYYREIAQFDALKNIIDSNTQKQQKADQILQIFKINKSNQEKYK
NKIKQELSQLNQYQTIDLNALKYFKNSILSQIELIDQNENLDTLLSLIANKTNNCNESYL
KSVQSELLKIQDLINNLNIDKDVFLQGKKQIQIEKLSQDQIECIETLVNKTVDLNEQYQQ
LKEEKDNNMIISSKLQPSSYLIQNQLFKLDNLLTKQKLENISKLLRSYDNEGNQKFEIVK
GDFFIFNMKIKQDCLYRIVINLEFKDSNKFLFIGLVSKSHKDQVYIHDKSIINSYTISNQ
GDRGVSKVIKGKCLRDVKYPEEYNQIEIRFCVKNKMFQVSDYPKRENINEINDDKLNLID
LNQEYYLGFELYYDKDCLTILECEELQYQN


>TTHERM_01040840(gene)
ATGGATAATATTTTAAATAATAGTTAAAATTTTAATCAGATACTTTGCTAAAAGCATGAA
TTGCCATGCTTATATTTAAAAGCTGATAGTGATAACTCTGATCATATCTATGCTTGCTCT
AATTGTATTTATTCTTATAATAATTTTAGAAAATATCTTTCTTTGCAAGATATAAAAGAT
AAATTAGACAATACAGTCTTAATGAATTGGCCACTTTTAGATGAATACGAATTAACAAAA
CAAATATAGTTGTTTTCTTAGTATTAAGGAGATTAAAAGTCAATTTAAAAAAATATTACT
AAGTTTTTTGAAGATTTATAAAATGAAATAGAACAAGCATTACAAAAATAAAAGAAGAAT
ATGTTAATCTATGCAGACACCATTTCCGAAAATACAAACTAGTTATTTGATTATTATCGA
GAAATAGCTTAATTTGATGCTCTAAAAAATATTATTGATTCAAATACATAAAAATAATAA
AAAGCTGATCAAATTTTATAAATATTTAAGATAAACAAATCGAATTAAGAAAAGTATAAA
AATAAAATTAAATAAGAATTATCTCAATTAAATTAATATTAAACCATTGATTTAAATGCA
CTGAAATATTTTAAAAATTCTATTTTATCCTAAATCGAGCTAATTGATTGTAAATATTTA
TCAAATTTACAGAATTTCTCTTATAAAAATAATACACTAATTGATGAATTTAAAAATGAA
TAACAAAATTAAAATATTTTATTAAAAGAAAATGAAAATTTAGATACTCTTCTCAGCCTT
ATAGCAAACAAAACTAACAATTGTAATGAAAGTTATCTTAAATCTGTTTAGTCTGAACTA
CTAAAAATTTAAGATTTAATAAATAACTTAAATATTGACAAGGATGTTTTTTTGTAAGGG
AAGAAATAAATTCAAATAGAAAAATTAAGCTAAGATCAAATTGAATGCATAGAAACACTT
GTAAACAAAACTGTAGATCTAAATGAATAATACTAATAATTGAAAGAAGAAAAAGATAAT
AATATGATCATCTCTTCAAAATTACAACCTTCCTCCTACCTAATTTAAAATTAGTTATTC
AAGCTAGATAATTTATTGACAAAATAGAAATTAGAAAATATCTCTAAGCTACTGAGAAGG
TTTCCTATTTTTGAAATCGAATAATTAGTCAAACCTTATCCTTGAAAGTTAGAAGTAGAA
ATAAGTAATTGGTAAAATTATAATACTAATGGAAAATAAAGCTATGATAATGAAGGCAAC
TAAAAATTTGAAATTGTTAAAGGAGATTTTTTTATTTTTAACATGAAAATAAAATAGGAT
TGTTTGTATAGAATAGTTATTAATCTTGAATTCAAAGATTCAAACAAATTTTTATTTATT
GGTTTAGTTAGTAAATCTCACAAAGATTAGGTATATATTCATGATAAAAGCATTATTAAT
AGTTATACAATAAGTAATCAAGGTGATCGTGGAGTTAGCAAAGTAATAAAAGGGAAATGC
TTGAGAGATGTGAAATATCCAGAAGAATATAATTAGATAGAAATAAGATTTTGTGTAAAA
AATAAAATGTTCTAAGTGAGTGATTATCCTAAAAGAGAAAATATTAATGAAATAAATGAT
GATAAGTTAAATTTAATAGACCTAAACTAAGAATATTATTTAGGATTTGAATTATATTAT
GACAAAGACTGTTTAACTATATTAGAGTGTGAAGAGCTATAATATTAAAATTGA