Identifiers and Description

Gene Model Identifier

TTHERM_00780520

Standard Name

JMJ4 (JmjC domain-encoding gene 4)

Aliases

PreTt01264 | 130.m00074 | 3738.m00010

Description

jmjC domain containing protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Biological Process

Domains

  • ( PF02373 ) JmjC domain
  • ( PF05214 ) Baculovirus P33
  • ( TIGR01612 ) rhoptry protein
  • ( PF08252 ) arg-2/CPA1 leader peptide
  • ( TIGR00184 ) adenylosuccinate synthetase
  • ( PF00027 ) cyclic nucleotide-binding domain
  • ( PF05501 ) Domain of unknown function (DUF755)
  • ( PF08133 ) Anticodon nuclease activator family
  • ( TIGR00864 ) polycystin cation channel protein
  • ( PF09006 ) Lung surfactant protein D coiled-coil

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.2%

TetraMine Data

TTHERM_00780520

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_18647.19.997093137033517e-262jmjC domain-containing protein
(1456 aa)
OxytrichaContig20132.0.g1060.0000000000002999981760818895Cyclic nucleotide-binding doma
in
Stentor CoeruleusSteCoe_52490.00012340980408667956

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:22427430: Chung PH, Yao MC (2012) Tetrahymena thermophila JMJD3 homolog regulates H3K27 methylation and nuclear differentiation. Eukaryotic cell 11(5):601-14

Sequences

>TTHERM_00780520(coding)
ATGAGTACTTTTACAGATTAAAATACTCACCCTTCAAGTTAAGATTTAGATTAAAGCAAT
TTTTTGGAACAAAAAAGTTCTGAAACAGACAATTTCAAGTAGCTAGAATCATAATTCCTT
CCAAGCAATATTCTTCAAATCCTATCAGAACAAAATAGGCCTGCTATTTAGGCAGAATAA
CTTGATGAATATTTTAAGAATTTAAGTTTTTTTGACAAGCTGCGCTCAGAGGGAGGTTCA
CAAATCAACGATCTGCTTCTTCATGAAGTTTGGAGAAATGTTGAGTTTGCTTAGTTAGAA
GCAAATACTTTAATATTTAAAGAAAAAGAGCCTTCTAATAATAAAATGTTTATAATATTG
AAAGGAAAAGTAGGTATTAACATTAAGCCACTTTAAGAAGAGTTATTTAATCAAGGTAAC
GAAAAAAACGAATAACCTACAAAATTATAAAAAGTTAACTCAAAACCCAAAGAAAATAAC
TAATAAAATGATTAATAAGCAGAAAGAAAAAATTCTTAATAAAATGCAGATGGTAACGAT
AATGAAAATAACAGAAATTAATCCTATTAGGTTTCTAATTAAAATAATTTTACTAAGTAA
AATGAAGCTTCAACTCCCTAAAAACATAATTAAACAACCTTTCGATTGGATTAGTAGCAT
ATAGATGAAAATTAACAAATGGATCAAAGCGATAGTGATAGTGATTAAGAAAATTAATAA
TCAGAATAATAAGAAAATAATCCTTTTCCTCAACTAGGTAGGAAAGTTGCTGAATTAGAA
TCAGGTAAAGCTTTTGGTGAATAGGCGCTATTTAAGGAAGGTGGGTTTAGAAATGCGAGC
GTTTATACACTTGAATAATCAAGTTTTTTAGTTATATGGAGGGATAAATTTTTAGGTGTA
CTTTCTGTTCTAGAATAAATAAAATAAGATAAAATTTAAAGGATAGGAAATGTTCTTCCT
TTTTTTAATGACATTGTTAGCTCCTAATTGAAAGATAGATTAGTTTATTTATTTGAAGAT
GTTAGCATCTCCAAAGGTACGATCCTCACATAAGAGAATGTTAAGGGATCTTATATATAT
ATTTTAAGAAGTGGTAGAGTTGCTCTTGAAAAAAGTATTACTTTAGAAGAATATAAAGAA
AAAGAAAGTTAGAGTGTAAGGAAATAAACTTTTTAACACAGATTCAGTGAATTTACAACA
GCAGAACTAATTGGAGATGAAATTTTAGAAGAAAAATCTAAAATATACTTCCATAAAAAG
AATCTAAAACCTTCTGAGTATTTGTTCACATCAATTGTTTTGTCCAGTGATTCTCAATTT
TTAAGGTTAGATAAAAAGAAAGTAATTGATGGATTTCCAAAGTACATAGTTGAGAAATTA
AGAGAAAATATGCTCATAAAAAAGAAGATGCGTGTAAAAATAATTGAAGACTATGTTTAG
AGAATATAGCCTAATTTTGTAGAATATTAAAAAAAAGATATAAATATGAAAAAGAGCTTA
GTTAAGAAATTTAAAATCTCAAATAATATTGTAGGACACCTTTTAGGTGAAAACACACCC
TTATCCTCTAGCTCTAGTCCTTCAAAGAAAGTGCAATTCTAAAATATAGTTAGAAATAGT
ATCCTACCTCTCTATAAAAATTAAATAAATTACTCTTTGGAAGCCAACAAAACACTTATT
TAAGATTTGCAAGTCATAAAATTAAAGAAGCAAAAAAGTAATTAATTTAAGAAAGATGCA
GATACCCCTACTCAATAGGATGGTTAAAAAAGTTATTTATTTTAATTAAATAATGAAGAG
AAAAGTCTGGGCATAAATGATAAATAAGGATAGTAATTAAATAGTGCTAGCTTTTCTAAT
AATTTTACAAAAAGGTAATAAAACTAAAAAGAAGATAATAGTTATACTGATAACTAACAT
GGAAGCGTTACTTCAAGATCTTAGTTTTCTAAAAGCAAAGTAACAAATAATTAATCAATT
TCTCTAGTAGATAATGGATTATAAGAAAGTTAAAACTATATACTTCCAAATGGGTATAGT
AGTTTTACTAATATTAATAATTAAGTAAAAAATAATCTTAATGGTAGTGTAAATGATATT
TAAAATGAGTATTTTTCTTAAGGAATTGATAAAAATTAAAAACACGTTAAATTAAGGTTA
TCCTAAAGTATCCCTTCACTTACAAATGTAGTTAGAACTGTTAACTCTGAATTAAAACCT
AATCCGAATTTCTTCTACAATCATGCTGAGAAGTTATAAAAGTAAAAAGTATTGAGTTAA
GAAGAAGAAAACAAGCTTAAATAAAAAAATTCTAATAATCCATCTAAAATTATGCAAGTA
TAGCAAGAAAAATAAAAAGTTGAACCACTTACTGAAGAATAAAACAGGAAAATATAAAAT
TATAAAAATTCACACATCAGTTAAATATCTAAAAAAATAGACTGTGACATTATGAAAAAG
GAGATTATTTATCAGCACATGACAAGCTTAAAAGAATAAAAGTTAATAAACCCCTTCGAA
GATTAGAACGCTAAAAGACAAAAGCAAATTCAAAAAGAAATTTAAGGAGTGATTTAGAAA
GTTTAAAAATATAGCTAAGAAATTTAATCTCACCCAAACTCATAGACTACCAAAATAAAA
AAAGCTGAAGAGAATAGAGGACCGAATTTATCACTAAAACCCATTTAGGAAACTAAATAA
GAAGAATTAACTTCTAAGCAATTTATAAACATAAGTAATTAAAATGTAACTTAGGGTTCT
GTAAGTTTAAGTGAATTTAGTAATGAAACAGTTACTTAGTCAATCAAGTTCAATACCAAA
CCTGATAGCAAAAAGATTGTTAAATTTTAAGCAGAAGCAGAAAAGACAGAAATACCTTCC
ACAATTTAAAGCTAAACAGAAAGAAATAAATCTAGCTAAAGACTAGAATCATACTTGCTA
CTCCAAGATACTGAAAGTACTAATAACCATGAACATGGAAGTAGTAGTAGTGGTAGTCAT
GATAGCAATGAAGATATAGATCCCATATAAAAAAAATTATCTGTTTTGTAAGGCAAACAT
AAAAAAAAATTTTATATGTTACAAGAAACTTGGGATTTAGGTGTTGAGAATTTAAAAATG
AAAGAACTTGATTTAAGAAATGATTTATAAAGAAAAGGTATTATTCACAAACCTCCTTTA
GAATAAACAAATAAGGATTAGTTTGAAAAGCTAGATCAACATTAATTGAAAATGTTTAAA
AAATATATGAAAAAAAAAACTAAATAGCTTCAAAAAGAAAAATAACAAATAAATAATCTG
TTTAGGATGATATAACCTGAAATAAAGGGTTAAGAAACTTACAATCAAAGTGAAATGAAA
TCAAAACTAAATTTAGATTTATAAATTCTCTAGTAGTTAGGTTAAAGTAATACATAATAG
TCTATTTCAAGTATTAAAACAATTACAGAGAGAACAGTTAATGAAAATAATCAAAATTAA
AACTCAGAATATATGTAAAACTCATAATAGAAAACAAATGATCATATTTAACAACAATCG
AGTCCTTAATTAAACTTCATTAATGGAAACGATAGTAATAATTTTAGTATATAATAAATG
AAGCCAAATTAAAATGCTTAAGCAAAATAAAAATAGAATTCTTAAGTTAGTATTTCTACT
GTTCAGCTTTCACTACCCTAGATTTCTCCTTCTAAAAAGTTATCTCATAAATATATAATA
TCTTAAAATTAAATTGGAGATAATTTTAATATCAACAATAGTTCTTACAAAGCAAAGACG
GAAGGAGATCTAGAGTTAGAACAAATAAGGATTTCTTCAGAAAAAGTTAGATATAATAAG
CTTATTAATTCACCAGATAAAAAATAGTCTTCTAGTATAATATTGGAATTAAGTCCTCTC
TTAGCAAGGCTTTAAATAAGTCAAAGTTCTACAAATTTAAGTTAAAGCATTTCTAATCCT
TAAAAATAAGTAATAGCTAATACTGAAAGGTAAAGCAAAGATTAGCAAAGTCAGAAAGCT
GCCATATTGAACTAATAATTGCCTAATATAGTTTATAATAACATTAATTCATACAAGACC
AGACCAAACCAAGAAATTTAGATTTTACAAAATAAGACCAAACAACTGAAACAGATGCAA
TAAATTGAATTTACTAAGAAAGAACTTCAAAAAATATCTTCCTCATCAAGTATGATATCT
CCAAACAGGCACTAAAATGAAGGTCTAAAATAATAATTATTTTTATCACCTTAAAGTGCA
AAATTACTATAAAAGATTTGA


>TTHERM_00780520(protein)
MSTFTDQNTHPSSQDLDQSNFLEQKSSETDNFKQLESQFLPSNILQILSEQNRPAIQAEQ
LDEYFKNLSFFDKLRSEGGSQINDLLLHEVWRNVEFAQLEANTLIFKEKEPSNNKMFIIL
KGKVGINIKPLQEELFNQGNEKNEQPTKLQKVNSKPKENNQQNDQQAERKNSQQNADGND
NENNRNQSYQVSNQNNFTKQNEASTPQKHNQTTFRLDQQHIDENQQMDQSDSDSDQENQQ
SEQQENNPFPQLGRKVAELESGKAFGEQALFKEGGFRNASVYTLEQSSFLVIWRDKFLGV
LSVLEQIKQDKIQRIGNVLPFFNDIVSSQLKDRLVYLFEDVSISKGTILTQENVKGSYIY
ILRSGRVALEKSITLEEYKEKESQSVRKQTFQHRFSEFTTAELIGDEILEEKSKIYFHKK
NLKPSEYLFTSIVLSSDSQFLRLDKKKVIDGFPKYIVEKLRENMLIKKKMRVKIIEDYVQ
RIQPNFVEYQKKDINMKKSLVKKFKISNNIVGHLLGENTPLSSSSSPSKKVQFQNIVRNS
ILPLYKNQINYSLEANKTLIQDLQVIKLKKQKSNQFKKDADTPTQQDGQKSYLFQLNNEE
KSLGINDKQGQQLNSASFSNNFTKRQQNQKEDNSYTDNQHGSVTSRSQFSKSKVTNNQSI
SLVDNGLQESQNYILPNGYSSFTNINNQVKNNLNGSVNDIQNEYFSQGIDKNQKHVKLRL
SQSIPSLTNVVRTVNSELKPNPNFFYNHAEKLQKQKVLSQEEENKLKQKNSNNPSKIMQV
QQEKQKVEPLTEEQNRKIQNYKNSHISQISKKIDCDIMKKEIIYQHMTSLKEQKLINPFE
DQNAKRQKQIQKEIQGVIQKVQKYSQEIQSHPNSQTTKIKKAEENRGPNLSLKPIQETKQ
EELTSKQFINISNQNVTQGSVSLSEFSNETVTQSIKFNTKPDSKKIVKFQAEAEKTEIPS
TIQSQTERNKSSQRLESYLLLQDTESTNNHEHGSSSSGSHDSNEDIDPIQKKLSVLQGKH
KKKFYMLQETWDLGVENLKMKELDLRNDLQRKGIIHKPPLEQTNKDQFEKLDQHQLKMFK
KYMKKKTKQLQKEKQQINNLFRMIQPEIKGQETYNQSEMKSKLNLDLQILQQLGQSNTQQ
SISSIKTITERTVNENNQNQNSEYMQNSQQKTNDHIQQQSSPQLNFINGNDSNNFSIQQM
KPNQNAQAKQKQNSQVSISTVQLSLPQISPSKKLSHKYIISQNQIGDNFNINNSSYKAKT
EGDLELEQIRISSEKVRYNKLINSPDKKQSSSIILELSPLLARLQISQSSTNLSQSISNP
QKQVIANTERQSKDQQSQKAAILNQQLPNIVYNNINSYKTRPNQEIQILQNKTKQLKQMQ
QIEFTKKELQKISSSSSMISPNRHQNEGLKQQLFLSPQSAKLLQKI


>TTHERM_00780520(gene)
ATAAAAAAAAAATAAACAATCATTATTATATTGGCTAATTTAAATAATTAATAAATAAAG
TAAATTAAGCAAATACTATCAGCTATGAGTACTTTTACAGATTAAAATACTCACCCTTCA
AGTTAAGATTTAGATTAAAGCAATTTTTTGGAACAAAAAAGTTCTGAAACAGACAATTTC
AAGTAGCTAGAATCATAATTCCTTGTATATTTTCTCAAATATAAATTACATCTTAATACA
TTTTTATAATCTAAATAATTTTATAGCCAAGCAATATTCTTCAAATCCTATCAGAACAAA
ATAGGCCTGCTATTTAGGCAGAATAACTTGATGAATATTTTAAGAATTTAAGTTTTTTTG
ACAAGCTGCGCTCAGAGGGAGGTTCACAAATCAACGATCTGCTTCTTCATGAAGTAAGAT
TAATTCTTTAGATCGAAATTAAATGCAATTTATTAAAAATTATTTGCTTAAATTATGCAT
GAATGAGTATTAGATAATGAAGTCAATACTATTTAAATATTATGTGATCAATAAATATAG
TGATAAAAGGTTTATTCAAAATTAAAGCAATTCATTTGGTTTTGAAAGAGAATTAAAAAA
CAAGAAAAAACTTTAGAATTTAAGTTATTTAATATATTCTCGCTAAAAATTGAAAATACA
AATTAAAAATATATACTTTATCTATATTTATTTATTTATGATATTAAATTTATAGTAACT
AATGAATTAATTTTTTGTTAATAGGTTTGGAGAAATGTTGAGTTTGCTTAGTTAGAAGCA
AATACTTTAATATTTAAAGAAAAAGAGCCTTCTAATAATAAAATGTTTATAATATTGAAA
GGAAAAGTAGGTATTAACATTAAGCCACTTTAAGAAGAGTTATTTAATCAAGGTAACGAA
AAAAACGAATAACCTACAAAATTATAAAAAGTTAACTCAAAACCCAAAGAAAATAACTAA
TAAAATGATTAATAAGCAGAAAGAAAAAATTCTTAATAAAATGCAGATGGTAACGATAAT
GAAAATAACAGAAATTAATCCTATTAGGTTTCTAATTAAAATAATTTTACTAAGTAAAAT
GAAGCTTCAACTCCCTAAAAACATAATTAAACAACCTTTCGATTGGATTAGTAGCATATA
GATGAAAATTAACAAATGGATCAAAGCGATAGTGATAGTGATTAAGAAAATTAATAATCA
GAATAATAAGAAAATAATCCTTTTCCTCAACTAGGTAGGAAAGTTGCTGAATTAGAATCA
GGTAAAGCTTTTGGTGAATAGGCGCTATTTAAGGAAGGTGGGTTTAGAAATGCGAGCGTT
TATACACTTGAATAATCAAGTTTTTTAGTTATATGGAGGGATAAATTTTTAGGTGTACTT
TCTGTTCTAGAATAAATAAAATAAGATAAAATTTAAAGGATAGGAAATGTTCTTCCTTTT
TTTAATGACATTGTTAGCTCCTAATTGAAAGATAGATTAGTTTATTTATTTGAAGATGTT
AGCATCTCCAAAGGTACGATCCTCACATAAGAGAATGTTAAGGGATCTTATGTAAACAAT
TATTTTTTTTCTTTCGTATTAAATCGATTTCAATAAAATTCTACTTGACAATTAAACAAA
ATTATTAATTTGAAACATCTTCTAATTTTTAATAAGTAATCTACAATCAGGAAAAAACAA
AAAAATTACTTTGTAATGTATAATTAAAAGAATAAACTTTTACATCATCTTCATCAATAG
AATTTTGTTTAAAATAAAATTAAACTAAAATTTTTTAAAAAAATGAATTTAATTTTTTTT
GTAAAAATGTAAAAAGATATATATTTTAAGAAGTGGTAGAGTTGCTCTTGAAAAAAGTAT
TACTTTAGAAGAATATAAAGAAAAAGAAAGTTAGAGTGTAAGGAAATAAACTTTTTAACA
CAGATTCAGTGAATTTACAACAGCAGAACTAATTGGAGATGAAATTTTAGAAGAAAAATC
TAAAATATACTTCCATAAAAAGAATCTAAAACCTTCTGAGTATTTGTTCACATCAATTGT
TTTGTCCAGTGATTCTCAATTTTTAAGGTTAGATAAAAAGAAAGTAATTGATGGATTTCC
AAAGTACATAGTTGAGAAATTAAGAGAAAATATGCTCATAAAAAAGAAGATGCGTGTAAA
AATAATTGAAGACTATGTTTAGAGAATATAGCCTAATTTTGTAGAATATTAAAAAAAAGA
TATAAATATGAAAAAGAGCTTAGTTAAGAAATTTAAAATCTCAAATAATATTGTAGGACA
CCTTTTAGGTGAAAACACACCCTTATCCTCTAGCTCTAGTCCTTCAAAGAAAGTGCAATT
CTAAAATATAGTTAGAAATAGTATCCTACCTCTCTATAAAAATTAAATAAATTACTCTTT
GGAAGCCAACAAAACACTTATTTAAGATTTGCAAGTCATAAAATTAAAGAAGCAAAAAAG
TAATTAATTTAAGAAAGATGCAGATACCCCTACTCAATAGGATGGTTAAAAAAGTTATTT
ATTTTAATTAAATAATGAAGAGAAAAGTCTGGGCATAAATGATAAATAAGGATAGTAATT
AAATAGTGCTAGCTTTTCTAATAATTTTACAAAAAGGTAATAAAACTAAAAAGAAGATAA
TAGTTATACTGATAACTAACATGGAAGCGTTACTTCAAGATCTTAGTTTTCTAAAAGCAA
AGTAACAAATAATTAATCAATTTCTCTAGTAGATAATGGATTATAAGAAAGTTAAAACTA
TATACTTCCAAATGGGTATAGTAGTTTTACTAATATTAATAATTAAGTAAAAAATAATCT
TAATGGTAGTGTAAATGATATTTAAAATGAGTATTTTTCTTAAGGAATTGATAAAAATTA
AAAACACGTTAAATTAAGGTTATCCTAAAGTATCCCTTCACTTACAAATGTAGTTAGAAC
TGTTAACTCTGAATTAAAACCTAATCCGAATTTCTTCTACAATCATGCTGAGAAGTTATA
AAAGTATGTTTTTTTTTTTTTTTTGAATTATATATGAACTAATATAACGTTAATTTTAGG
TAAAAAGTATTGAGTTAAGAAGAAGAAAACAAGCTTAAATAAAAAAATTCTAATAATCCA
TCTAAAATTATGCAAGTATAGCAAGAAAAATAAAAAGTTGAACCACTTACTGAAGAATAA
AACAGGAAAATATAAAATTATAAAAATTCACACATCAGTTAAATATCTAAAAAAATAGAC
TGTGACATTATGAAAAAGGAGATTATTTATCAGCACATGACAAGCTTAAAAGAATAAAAG
TTAATAAACCCCTTCGAAGATTAGAACGCTAAAAGACAAAAGCAAATTCAAAAAGAAATT
TAAGGAGTGATTTAGAAAGTTTAAAAATATAGCTAAGAAATTTAATCTCACCCAAACTCA
TAGACTACCAAAATAAAGTAACTTAATTGAGTAAGAATTTATATTTCAATACTTTTTAAA
ATTTATTTAGAAAAGCTGAAGAGAATAGAGGACCGAATTTATCACTAAAACCCATTTAGG
AAACTAAATAAGAAGAATTAACTTCTAAGCAATTTATAAACATAAGTAATTAAAATGTAA
CTTAGGGTTCTGTAAGTTTAAGTGAATTTAGTAATGAAACAGTTACTTAGTCAATCAAGT
TCAATACCAAACCTGATAGCAAAAAGATTGTTAAATTTTAAGCAGAAGCAGAAAAGACAG
AAATACCTTCCACAATTTAAAGCTAAACAGAAAGAAATAAATCTAGCTAAAGACTAGAAT
CATACTTGCTACTCCAAGATACTGAAAGTACTAATAACCATGAACATGGAAGTAGTAGTA
GTGGTAGTCATGATAGCAATGAAGATATAGATCCCATATAAAAAAAATTATCTGTTTTGT
AAGGCAAACATAAAAAAAAATTTTATATGTTACAAGAAACTTGGGATTTAGGTGTTGAGA
ATTTAAAAATGAAAGAACTTGATTTAAGAAATGATTTATAAAGAAAAGGTATTATTCACA
AACCTCCTTTAGAATAAACAAATAAGGATTAGTTTGAAAAGCTAGATCAACATTAATTGA
AAATGTTTAAAAAATATATGAAAAAAAAAACTAAATAGCTTCAAAAAGAAAAATAACAAA
TAAATAATCTGTTTAGGATGATATAACCTGAAATAAAGGGTTAAGAAACTTACAATCAAA
GTGAAATGAAATCAAAACTAAATTTAGATTTATAAATTCTCTAGTAGTTAGGTTAAAGTA
ATACATAATAGTCTATTTCAAGTATTAAAACAATTACAGAGAGAACAGTTAATGAAAATA
ATCAAAATTAAAACTCAGAATATATGTAAAACTCATAATAGAAAACAAATGATCATATTT
AACAACAATCGAGTCCTTAATTAAACTTCATTAATGGAAACGATAGTAATAATTTTAGTA
TATAATAAATGAAGCCAAATTAAAATGCTTAAGCAAAATAAAAATAGAATTCTTAAGTTA
GTATTTCTACTGTTCAGCTTTCACTACCCTAGATTTCTCCTTCTAAAAAGTTATCTCATA
AATATATAATATCTTAAAATTAAATTGGAGATAATTTTAATATCAACAATAGTTCTTACA
AAGCAAAGACGGAAGGAGATCTAGAGTTAGAACAAATAAGGATTTCTTCAGAAAAAGTTA
GATATAATAAGCTTATTAATTCACCAGATAAAAAATAGTCTTCTAGTATAATATTGGAAT
TAAGTCCTCTCTTAGCAAGGCTTTAAATAAGTCAAAGTTCTACAAATTTAAGTTAAAGCA
TTTCTAATCCTTAAAAATAAGTAATAGCTAATACTGAAAGGTAAAGCAAAGATTAGCAAA
GTCAGAAAGCTGCCATATTGAACTAATAATTGCCTAATATAGTTTATAATAACATTAATT
CATACAAGACCAGACCAAACCAAGAAATTTAGATTTTACAAAATAAGACCAAACAACTGA
AACAGATGCAATAAATTGAATTTACTAAGAAAGAACTTCAAAAAATATCTTCCTCATCAA
GTATGATATCTCCAAACAGGCACTAAAATGAAGGTCTAAAATAATAATTATTTTTATCAC
CTTAAAGTGCAAAATTACTATAAAAGATTTGA