Identifiers and Description

Gene Model Identifier

TTHERM_00467690

Standard Name

JMJ3 (JmjC domain-encoding gene 3)

Aliases

PreTt18671 | 55.m00226 | 3710.m00075

Description

jmjC domain containing protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Biological Process

Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.2%

TetraMine Data

TTHERM_00467690

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_15726.19.997093137033517e-262jmjC domain-containing protein
(504 aa)
OxytrichaContig9894.0.g515.0019535966450705e-92JmjC domain, hydroxylase
SGDYER169W8.003951791518226e-58RPH1 JmjC domain-containing hi
stone demethylase; specificall
y demethylates H3K36 tri- and
dimethyl modification states;
associates with actively trans
cribed (RNA polymerase II) reg
ions in vivo and specifically
targets H3K36 in its trimethyl
ation state as its substrate;
transcriptional repressor of P
HR1; Rph1p phosphorylation dur
ing DNA damage is under contro
l of the MEC1-RAD53 pathway
WormBaseWBGene000129822.0008958828286524e-54locus:jmjd-2 Lysine-specific
demethylase 4 status:Partia
lly_confirmed UniProt:Q9U297
protein_id:CAB54451.2
Stentor CoeruleusSteCoe_106942.031092662734811e-42
DictyBaseDDB_G02687787.003307964816097e-28rbbB on chromosome: 1 position
2082803 to 2086499

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:22427430: Chung PH, Yao MC (2012) Tetrahymena thermophila JMJD3 homolog regulates H3K27 methylation and nuclear differentiation. Eukaryotic cell 11(5):601-14

Sequences

>TTHERM_00467690(coding)
ATGGCCAGTACTAGCACAATGCAATCAAGGGAATCAGATTCAAATACTATCCCCTTTTGT
CCAATCGTTCATCCTACCTAAAAGGAATTTAACGATTTTAACACTTATATTGAGAAATTA
GAAAAAGAATATTCATAAAATTATGGCATGGTTAAAGTCGTTCCTCCCAAATCTTGGAAG
GCGAGACAGGCTGACTATGAAGAAAGCCTTGATGATAAAATGATTGTTGGCCCTATTGAA
TAAAATCCTTATGGCAAAGGAGGTATCTATGAATGCATCCATATTATGAAAAAGTCGATA
CCTTTCCGTGAATACAAAAAAAAAGCAAGGGATTTTGATAAGGTAACTGATAATAAAACT
ATTGAGAAGGTTGAAGATTTGTTTTGGAAGAATATCTCTTTCAGTCCTCCTCTATACGGT
TCAGACATGCAAATGAGTCTCTTCGATGACGGCGTTAAATGGAATATGAAAGAAATGCGC
TCTATCATGAATGATGGTTTGACTTCTAATATTGCTGGTGTTAATACTCCCTATTTATAT
ATTGGAAGCTGGAAAACTTTGTTCGCTTGGCATAAAGAAGATCTTGATTTAGGAGCTCTG
AACTACCTCCATTACGGAAAACCAAAATTCTGGTATTGCATCGCTAGATCAGACGCTCAC
AAGCTTGAGTCATTTGCAAAGGCTAATTTTGCAGAAAGCTTTGCTAAATGTCCTGAATTC
CTCAGACACAAAACTACTGTGATTAATCCTTACTAAATGATAAAGAAATTAAAAGGTGAT
ATTAAGATTTCTAAGATGTCTCAAGAAGCTGGTGAATTCATAGTTGTATTCAGTGGAGCT
TACCATCATGGTTTTAATTGGGGATACAATATTGCTGAAGCTGTTAATTATGCTACACTT
GGATGGTTAGACTTTTTCCCTCAATCCAAATAATGTAGATGTGCCTCAGATAATGTTAGT
ATCGATCACAACGATTTCATACTTACTCTTCTTAAAAATCGCCCTGAATTAAAAAATAGA
ACTGAAGTGAAAAATTTCTAAGCTTGGTTAAAATAAAAATAATTAGAGGAATAAGAAAAT
ATGGCGAGTGAAGAGGAAACCAGCAAAGAATAAAATTCAAGTGAAGAGTAAGTTGAAATG
AAAAAATCTATGATACCAGTAGTTGTACCTGAAAAAAAGAAAAGAGGACGTAAAAGTAAA
AAAGCTGCCACCATAGAATCTGATGAAGACTCAAATAATCACAAGGCAGAGACTAGAGAG
AACTCAACTGAACCTTAGAGAATTCAAAAGAAAATATAAAAGGCTGAAAAATAATCTAAA
TAAAAACTGAAAAAAGAATAGAATTAACAAAAAAAATCAGTAAAAAATTTAAATGAAGCA
AACAAAGCATTATCTTCCCCCATATAATAAACTGAATAGTCTTTAACATAAAGCCCTCCT
TAATCTAATCGTAAGACAAGCAGAAAGAACTCATTGAATATGGAAGTAGAAAAGGTTGAG
TAAGAAGTTAATTGA


>TTHERM_00467690(protein)
MASTSTMQSRESDSNTIPFCPIVHPTQKEFNDFNTYIEKLEKEYSQNYGMVKVVPPKSWK
ARQADYEESLDDKMIVGPIEQNPYGKGGIYECIHIMKKSIPFREYKKKARDFDKVTDNKT
IEKVEDLFWKNISFSPPLYGSDMQMSLFDDGVKWNMKEMRSIMNDGLTSNIAGVNTPYLY
IGSWKTLFAWHKEDLDLGALNYLHYGKPKFWYCIARSDAHKLESFAKANFAESFAKCPEF
LRHKTTVINPYQMIKKLKGDIKISKMSQEAGEFIVVFSGAYHHGFNWGYNIAEAVNYATL
GWLDFFPQSKQCRCASDNVSIDHNDFILTLLKNRPELKNRTEVKNFQAWLKQKQLEEQEN
MASEEETSKEQNSSEEQVEMKKSMIPVVVPEKKKRGRKSKKAATIESDEDSNNHKAETRE
NSTEPQRIQKKIQKAEKQSKQKLKKEQNQQKKSVKNLNEANKALSSPIQQTEQSLTQSPP
QSNRKTSRKNSLNMEVEKVEQEVN


>TTHERM_00467690(gene)
ATGGCCAGTACTAGCACAATGCAATCAAGGGAATCAGATTCAAATACTATCCCCTTTTGT
CCAATCGTTCATCCTACCTAAAAGGAATTTAACGATTTTAACACTTATATTGAGAAATTA
GAAAAAGAATATTCATAAAATTATGGCATGGTTAAAGTATGTCGTTTGTTTAATTTTCAA
ATTCACCCAATTTGCAAATGTTTTTTCATTTAAAAAGCTATTATTTGCCATTAAATTAGA
AAATGCTTGATTTTTGTTTGCATTCGCACAAGTATTGATTAGTTAGCAAACCCAATTTCG
TTATATTTTCATTCAATCGCGCTTATTTCAACAAACTTTTTTTTTTAAGTGCTCTCATTT
TGCTTAGTTTTAATTTTATTTATTGTCTAAATTCTATGTGTTTCTCTTAATTTTAGTGGA
TATGTTTATTTTTAAGGCAATAGCTATAAATAAATAAATAAATCAACCAATCTTCTGCAG
TGTGAAAACTTTTTATTCAATAAACTCAAGCTAACTAGCTAACTAACTAAAATCAAACAA
TTAAACTATTAAAAACTTCTTCAAATTCTGATTAGTATATTAATTAAATTATTTTTATTT
GTATTTTCTCCTAAAGGTCGTTCCTCCCAAATCTTGGAAGGCGAGACAGGCTGACTATGA
AGAAAGCCTTGATGATAAAATGATTGTTGGCCCTATTGAATAAAATCCTTATGGCAAAGG
AGGTAAATAATTAACTTCTACTCATTCTTATATATTTTCTACTTTATTTTCCTAATAATA
AAATATAAAATAATCTAGTTTCTTATTTTTGAACCTTCAAACAACCCTTTTCTTTTTTTT
TTTTCGATACAATCTTTAATTAAATATTTAATTAAAAGGGATAATTATTAATTTTACAAA
CTTTCTCCTTTCCTCTATTTTAAAAGCCCTTTTTTCCCCCTCCTTCAACTCACTGTTTAA
ATTAATTTCTTATATTAAGAAAATTTAATTCCCTCCCAAGCAGCGGGATGATTCATTAAT
TCATTCCAAAAATCGCTTGAAAGCAAAGATTATCCAATCAGATTATGACTTTTTGTCATT
TCTGATTAATAACAACAAAAAACATTATATCTATCAATCTCTTTTCTTTAAATATACTAG
TAAATATTTTAACCATTTTCTATTTATTTATAGGTATCTATGAATGCATCCATATTATGA
AAAAGTCGATACCTTTCCGTGAATACAAAAAAAAAGCAAGGGATTTTGATAAGGTAACTG
ATAATAAAACTATTGAGAAGGTTGAAGATTTGGTAAGATTTTTATTTCATTTCTACTTAT
GCAACAAATTTCCATCAACAAATCGTTGCTCATAATTCTTTTATAACAAAAATGCAGTTT
TGGAAGAATATCTCTTTCAGTCCTCCTCTATACGGTTCAGACATGCAAATGAGTCTCTTC
GATGACGGCGTTAAATGGAATATGAAAGAAATGCGCTCTATCATGAAGTAATTTAAACTA
TTTAATTCTTAAATTTAATTAAAAATTCTAATTTAATTAAATAACTTTACTTTTGTAAAT
ATTAAAAGTGATGGTTTGACTTCTAATATTGCTGGTGTTAATACTCCCTATTTATATATT
GGAAGCTGGAAAACTTTGTTCGCTTGGCATAAAGAAGATCTTGATTTAGGAGCTCTGAAC
TACCTCCATTACGGAAAACCAAAGTAAAAATTTAATTCATTAATTTAATTTGGTATGCTT
TATAATTTTTATTTAAATATACTTTTATTATTTTTATAGATTCTGGTATTGCATCGCTAG
ATCAGACGCTCACAAGCTTGAGTCATTTGCAAAGGCTAATTTTGCAGAAAGCTTTGCTAA
ATGTCCTGAATTCCTCAGACACAAAACTACTGTGATTAATCCTTACTAAATGATAAAGAA
ATTAAAAGGTGATATTAAGATTTCTAAGATGTCTCAAGAAGCTGGTGAATTCATAGTTGT
ATTCAGTGGAGCTTACCATCATGGTTTTAATTGGGGATACAATATTGCTGAAGCTGTTAA
TTATGCTACACTTGGATGGTTAGACTTTTTCCCTCAATCCAAATAATGTAGATGTGCCTC
AGATAATGTTAGTATCGATCACAACGATTTCATACTTACTCTTCTTAAAAATCGCCCTGA
ATTAAAAAATAGAACTGAAGTGAAAAATTTCTAAGCTTGGTTAAAATAAAAATAATTAGA
GGAATAAGAAAATATGGCGAGTGAAGAGGAAACCAGCAAAGAATAAAATTCAAGTGAAGA
GTAAGTTGAAATGAAAAAATCTATGATACCAGTAGTTGTACCTGAAAAAAAGAAAAGAGG
ACGTAAAAGTAAAAAAGCTGCCACCATAGAATCTGATGAAGACTCAAATAATCACAAGGC
AGAGACTAGAGAGAACTCAACTGAACCTTAGAGAATTCAAAAGAAAATATAAAAGGCTGA
AAAATAATCTAAATAAAAACTGAAAAAAGAATAGAATTAACAAAAAAAATCAGTAAAAAA
TTTAAATGAAGCAAACAAAGCATTATCTTCCCCCATATAATAAACTGAATAGTCTTTAAC
ATAAAGCCCTCCTTAATCTAATCGTAAGACAAGCAGAAAGAACTCATTGAATATGGAAGT
AGAAAAGGTTGAGTAAGAAGTTAATTGA