Identifiers and Description

Gene Model Identifier

TTHERM_00455500

Standard Name

JMJ2 (JmjC domain-encoding gene 2)

Aliases

PreTt20279 | 53.m00181 | 3712.m00042

Description

jmjC domain containing protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Biological Process

Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.1%

TetraMine Data

TTHERM_00455500

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_13742.19.997093137033517e-262jmjC domain-containing protein
(678 aa)
OxytrichaContig16165.0.1.g657.002855521298715e-86JmjC domain, hydroxylase
DictyBaseDDB_G02687783.999543040313994e-55rbbB on chromosome: 1 position
2082803 to 2086499
WormBaseWBGene000043196.001502944943701e-53locus:rbr-2 Lysine-specific
demethylase rbr-2 status:Par
tially_confirmed UniProt:Q23
541 protein_id:CAA93426.2
SGDYJR119C2.9995979253168707e-35JHD2 JmjC domain family histon
e demethylase specific for H3-
K4 (histone H3 Lys4); removes
methyl groups specifically add
ed by Set1p methyltransferase;
protein levels regulated by N
ot4p (E3 ubiquitin ligase) pol
yubiquitin-mediated degradatio
n
Stentor CoeruleusSteCoe_292558.533047625744066e-17

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:22427430: Chung PH, Yao MC (2012) Tetrahymena thermophila JMJD3 homolog regulates H3K27 methylation and nuclear differentiation. Eukaryotic cell 11(5):601-14

Sequences

>TTHERM_00455500(coding)
ATGGGTAGAGGTGATAGGTGCAGTGTTAGAACTAAAAAATGCCCAAAAACGGCTGAAAAA
TCTAAACAAAAGGCACATACAAAATAAATATCAAAAAAAATTTAAAACTCTCACGGGAAT
ACGTGCACCATAAATGTAAACACCCATGCTATACTAAGTAACTCAACAGCTATAAAGGTA
AAGGCTAGAAAGGTATCTTAAAAACGCATACCTTCCAATAAAATGATTTCCACTGAAGAT
TAGAAAGTAGAAAGAAATGTTAAAAATCCATCGCTTATACTTATTGAAGATGAATCCCAT
TCCACGAATTTTGAATCATACGCAAGTCCGAGAATGAATTGTGTAGTAAGCTAGTCACCA
GCTAATAGCCCTTCTTAAGACTATAATAATTAAGACTATTGCTCTCATAACTAGCATTTG
CACCCGAACTAGAACTCAATATTCTACTCAATGAGATGCGGTGGCAATGTATAGTAGTAG
TCTAGAAATGGTAGCAAGACTTCTATTGAGAACATTAAATCACATCAATCAATCAATTTT
TAGGGTGAAGATCTATTAAGTCTTAATCCACTTTAAAACCCTAAAATGCGCTTACCTTCC
GAGTATTCTTCTTTTATCGAAGTACCTACAGTATTTCCTACTGAAGAGGAATTCAAAGAC
CCCTATAAATTATTTGCTATGTTACATCAATAGGGTTATCACAAACATGGAATAGTTAAA
ATTATCCCTCCTAAGTCTTGGAAACCCTAATATAATTTTGATAAAATTACAGAAAAAGTT
ACAACAAGAACTCAAATCTTGGCTGAGCTCTCGCAAGCCTAGCCTTTCTCTTAAAATAAT
GACTAATACACTTACAAAGAATTTAAAAAGATGGCAGATGATTTTAAAAAAACGTATAAA
TTTTAGACCAAAACAAACTTTTAGAACGAATATCGTTAAATTGAATATGAGTTTTGGGAG
CATGTAGAGCACCCCGAACTATTCAAGGACGAGCTAGAAGTTGAATATGCTGCCGACTTA
CCCTCAAAAAAATATGGATCAGCATTCTCTGTTATGGATAACATGCACAACTCTACCTTC
AATTTGAATAACATCAACTCTATAAAAAATTCTCTATTTTAGCACTTTTCTAAAGACCAC
AGTGGCATAAGTGGGATCAGTAATCCTTGGGTATATTTAGGAATGATGTTTGCTTCTTTT
TGCTGGCACGTAGAAGATTTATATATGTGCGCCTTAAATTATTTACACATAGGAGAAGCT
AAAACTTGGTATGGCATTCCTCCAGAATACAAATACAAGTTTGAAGAAGTCTATAAGAAA
ACATATCCTCAAATTTTCAAAAAGAAGCCTGATGTTTTATTTCACATTAATTTGATGCTA
TCTCCTGCTGTTGCTTTAGAAAATGGGATACCAGTTTACAGAACTGAATAAAAACCAGGC
GAGTTTATATTTACATTCCCTAAAACATACCATGCTGGATTCTCTCATGGATTTAATTGT
GGAGAGGCTGTGAATGTAATTACTTTTGATTGGTTCTAAAATTATTAAGAGGCTGTATAG
TACTATTAAACAATAAAACACCCGACTAAAAATTATTTTAAGAGTGCCTCTTTTGCTGTT
GAATGGTTAATTTCTTAAGTTATTATGAACATGGAATAATCAAAATTCGATCTTTCAACT
TTAGTTAAAATAAAAGAGGAATGGAGCAAAATTGTTTAAGCAGAGTAGTAAAAAAGAAAA
AAAGTTTTAGCCAAATATGGAGAAGAAAATGTAAAAATATGCGAGTTTTCAAACAAAAAG
GAAAGATATGACAGACATATCTGCTGGCTTTGTGGATATTATAGTTTTTACAGCTACTTA
TTTTGTAATAGTTGTATTAAAAAGAGTTGCACCAGCCATGATACTCCTTGTAAGTGCAAT
AAAACTCCTTAACTTTTCATTCGCTTTACAGATGAGGACTTTGCAGAGTAGGAAGAAATA
ATAAATTAAAAAATGAAAGAATGCTCCTAATGA


>TTHERM_00455500(protein)
MGRGDRCSVRTKKCPKTAEKSKQKAHTKQISKKIQNSHGNTCTINVNTHAILSNSTAIKV
KARKVSQKRIPSNKMISTEDQKVERNVKNPSLILIEDESHSTNFESYASPRMNCVVSQSP
ANSPSQDYNNQDYCSHNQHLHPNQNSIFYSMRCGGNVQQQSRNGSKTSIENIKSHQSINF
QGEDLLSLNPLQNPKMRLPSEYSSFIEVPTVFPTEEEFKDPYKLFAMLHQQGYHKHGIVK
IIPPKSWKPQYNFDKITEKVTTRTQILAELSQAQPFSQNNDQYTYKEFKKMADDFKKTYK
FQTKTNFQNEYRQIEYEFWEHVEHPELFKDELEVEYAADLPSKKYGSAFSVMDNMHNSTF
NLNNINSIKNSLFQHFSKDHSGISGISNPWVYLGMMFASFCWHVEDLYMCALNYLHIGEA
KTWYGIPPEYKYKFEEVYKKTYPQIFKKKPDVLFHINLMLSPAVALENGIPVYRTEQKPG
EFIFTFPKTYHAGFSHGFNCGEAVNVITFDWFQNYQEAVQYYQTIKHPTKNYFKSASFAV
EWLISQVIMNMEQSKFDLSTLVKIKEEWSKIVQAEQQKRKKVLAKYGEENVKICEFSNKK
ERYDRHICWLCGYYSFYSYLFCNSCIKKSCTSHDTPCKCNKTPQLFIRFTDEDFAEQEEI
INQKMKECSQ


>TTHERM_00455500(gene)
ATGGGTAGAGGTGATAGGTGCAGTGTTAGAACTAAAAAATGCCCAAAAACGGCTGAAAAA
TCTAAACAAAAGGCACATACAAAATAAATATCAAAAAAAATTTAAAACTCTCACGGGAAT
ACGTGCACCATAAATGTAAACACCCATGCTATACTAAGTAACTCAACAGCTATAAAGGTA
AAGGCTAGAAAGGTATCTTAAAAACGCATACCTTCCAATAAAATGATTTCCACTGAAGAT
TAGAAAGTAGAAAGAAATGTTAAAAATCCATCGCTTATACTTATTGAAGATGAATCCCAT
TCCACGAATTTTGAATCATACGCAAGTCCGAGAATGAATTGTGTAGTAAGCTAGTCACCA
GCTAATAGCCCTTCTTAAGACTATAATAATTAAGACTATTGCTCTCATAACTAGCATTTG
CACCCGAACTAGAACTCAATATTCTACTCAATGAGATGCGGTGGCAATGTATAGTAGTAG
TCTAGAAATGGTAGCAAGACTTCTATTGAGAACATTAAATCACATCAATCAATCAATTTT
TAGGGTGAAGATCTATTAAGTCTTAATCCACTTTAAAACCCTAAAATGCGCTTACCTTCC
GAGTATTCTTCTTTTATCGAAGTACCTACAGTATTTCCTACTGAAGAGGAATTCAAAGAC
CCCTATAAATTATTTGCTATGTTACATCAATAGGGTTATCACAAACATGGAATAGTTAAA
ATTATCCCTCCTAAGTCTTGGAAACCCTAATATAATTTTGATAAAATTACAGAAAAAGTT
ACAACAAGAACTCAAATCTTGGCTGAGCTCTCGCAAGCCTAGGTAAATATTTAGAATATT
TAAATAAATATAAAATGATGGAGAATTTTTAGTATGTTTCTTAAAGTAGGAGTGATATTA
AAGGGAGTATAAAAATCTTAAAATAAATCTATTTTTACTTTTTTTGACATTAAAAAATAG
CTTTGATTAAGCTAATACAAATATAATTTCTGATTCAGCTGTCTCTTAATATTGATTATA
AAAATTCAGCTTCTAAATTTATAGACATAGCAGAATGAATCTAAATGAGTGGATTTTATT
GCACCAAATTTATTTTACTCTAATCCTACTTTTATAGCTCTTATTAAAAACAAACAAATT
AATTTCTCCTTCTTTACTTAAAAAATTAATCAGCGGTTCAATAATTTTACAAAATAATTT
TGTATGAACTTGATAAAATATTAATATTTTATTTTTAAAATATATTTATTAATAGCCTTT
CTCTTAAAATAATGACTAATACACTTACAAAGAATTTAAAAAGATGGCAGATGATTTTAA
AAAAACGTATAAATTTTAGACCAAAACAAACTTTTAGAACGAATATCGTTAAATTGAATA
TGAGTTTTGGGAGCATGTAGAGCACCCCGAACTATTCAAGGACGAGCTAGAAGTTGAATA
TGCTGCCGACTTACCCTCAAAAAAATATGGATCAGCATTCTCTGTTATGGATAACATGCA
CAACTCTACCTTCAATTTGAATAACATCAACTCTATAAAAAATTCTCTATTTTAGCACTT
TTCTAAAGACCACAGTGGCATAAGTGGGATCAGTAATCCTTGGGTATATTTAGGAATGAT
GTTTGCTTCTTTTTGCTGGCACGTAGAAGATTTATATATGTGCGCCTTAAATTATTTACA
CATAGGAGAAGCTAAAACTTGGTAATTATTTTATTATTTTATCCTCAATTTAATGAATAA
ATTTTTTTTTCTATTTCCTTCATTAAAACTTTTAGCTTATTTTTCTATTTCGAATTATTT
TTTGTGTGATAATTTAAAAAAATCACAATCTAAAAAGATTAAATGGCTTCCTTCATTATT
TTAAATTACATTTATTATTTTAAGGAAAGCCATTCATTCTACTAATCCTAATTAATTCAA
TCATATTTTTACATATCAATCTATTAATTATGCATTGGCTAGATAGATCGCATTCAAGTT
TTTTTAAATACAAGCAAATTCCCCCCTTTATTCATATGTATTCATTTACAATACAAAGAC
TATTAAATAAATGTATTAAATCAAGATTCTTTACTATCTGCACATTTTGTAAATATTCAT
ATTATGGAAATCTAACAGATGGAGGTTTTATTAATTTTTATCTAAGGAATTATTAAATTA
CGTCATATCACATTAGTATTTTTAGATAAAATTTAAAAAATTCCAACTTAAATTTTGCAC
TTTTTTAATACTTTTTTCTTCCAAAATTGAAAAAAATTAATGCATTTGATAAAGATTAAA
GTTATATTTAAATAATCATTAAGAAATTTAAGTCGTTTAAATTAACTGCAAGTCTCATTT
CAAATTTATTTTTTTTAAAAGGTATGGCATTCCTCCAGAATACAAATACAAGTTTGAAGA
AGTCTATAAGAAAACATATCCTCAAATTTTCAAAAAGAAGCCTGATGTTTTATTTCACAT
TAATTTGATGCTATCTCCTGCTGTTGCTTTAGAAAATGGGATACCAGTTTACAGAACTGA
ATAAAAACCAGGCGAGTTTATATTTACATTCCCTAAAACATACCATGCTGGATTCTCTCA
TGGATTTAATTGTGGAGAGGCTGTGAATGTAATTACTTTTGATTGGTTCTAAAATTATTA
AGAGGCTGTATAGTACTATTAAACAATAAAACACCCGACTAAAAATTATTTTAAGAGTGC
CTCTTTTGCTGTTGAATGGTTAATTTCTTAAGTTATTATGAACATGGAATAATCAAAATT
CGATCTTTCAACTTTAGTTAAAGTAATTTTCTTGAAAATTAGCAAGCATTAATTTAATTT
TTTTAAACATTTTAAATAAAATTTATATTTGTTATTAAACTTAGATAAAAGAGGAATGGA
GCAAAATTGTTTAAGCAGAGTAGTAAAAAAGAAAAAAAGTTTTAGCCAAATATGGAGAAG
AAAATGTAAAAATATGCGAGTTTTCAAACAAAAAGGAAAGATATGACAGACATATCTGCT
GGCTTTGTGGATATTATAGTTTTTACAGCTACTTATTTTGTAATAGTTGTATTAAAAAGA
GTTGCACCAGCCATGATACTCCTTGTAAGTGCAATAAAACTCCTTAACTTTTCATTCGCT
TTACAGATGAGGTAATTATAATTTATAAATAAATTAGCTTTCTTTACTTTAGAAACATTT
AAAAAATAAATGAATAAAATATAATATATTTTTTTACAAAAAAAGGACTTTGCAGAGTAG
GAAGAAATAATAAATTAAAAAATGAAAGAATGCTCCTAATGA