Identifiers and Description

Gene Model Identifier

TTHERM_00185640

Standard Name

JMJ1 (JmjC domain-encoding gene 1)

Aliases

PreTt29886 | 14.m00453

Description

jmjC domain containing protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Biological Process

Domains

  • ( PF02373 ) JmjC domain
  • ( PF09022 ) Staphostatin A
  • ( PF08323 ) Starch synthase catalytic domain
  • ( PF05864 ) Chordopoxvirus DNA-directed RNA polymerase 7

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00185640

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_09915.19.997093137033517e-262jmjC domain-containing protein
(1133 aa)
WormBaseWBGene000090899.995317835403734e-19locus:jmjd-3.2 status:Partia
lly_confirmed UniProt:Q19760
protein_id:CAA94916.1
Stentor CoeruleusSteCoe_211854.248354255291589e-18

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:26688337: Kataoka K, Mochizuki K (2015) Phosphorylation of an HP1-like Protein Regulates Heterochromatin Body Assembly for DNA Elimination. Developmental cell 35(6):775-88
  2. Ref:22427430: Chung PH, Yao MC (2012) Tetrahymena thermophila JMJD3 homolog regulates H3K27 methylation and nuclear differentiation. Eukaryotic cell 11(5):601-14

Sequences

>TTHERM_00185640(coding)
ATGAATCTTAGGAACAAGAGAAAGGTTTCTTCAAGTACTAGCGAAGAAAAAGACTAACAC
TTTAGTTCTAGCCTGATTTAAACTAATGAAAATATAAATTCGAATGCAACAACTTCGGTC
AATATCGATTCTACTGCAGCATACAATATTTCTTAGGAAAAAGAAGGTTCTCCTAAAAAG
AATGGATTGGCAGCTAACTCCAGCAGCACTTTCGTCTCCACAACTGACTAAATCCTAATA
AATGGAAACAACGTATCAAAGAAAATCAAGACAAATAGCGGTGCTGCATTTCAAACTTAA
GTTTCTGCGAATGCTCCTTGCTTAAAATCAGCAGAACAAATTATTTAGCATTAGTAGAAT
GTTAATAATGATTGTGATATTGACTGCGATGGATTTCGCGAAATATTTCCTGAAGACCTA
CACACATAGTTGTAGGAAGCAATTTATAAAGAATAAACCATCGTTTTGAGAGAAGCAGCT
GGCCCTAAAGGTTTTAATGTGAACCCCAAAAACTTATTTAGCTTTGAAAGTGTGATTAAA
AATCATAGCGATATGTAAATTGACTGTAGAGTTTAAAATCCTACAGTTTATGGCTTTAAT
GTTTTAAATCCCAAAAACCAATAGCATGTCTACAATACCACCATTTAGGAATACGGAGAG
TATGCTGCATTGCTTTAAGAAGACAGGTACGAAGAAATTAAGAAAAAACCATATTACAAA
GAATACTTTAGCAAACTATCTAACGGAGTAATGTTTGCTGTAAACATTGACATGGATGAT
TTTAATTGGTAAACCGAAAACATGCGTCTGAGATCAGGGCTTCCCCATTACCTCCTAAAT
AAAGGCAAACATGATATCCTTAGCTACCATAGGTAAAACGTTATGGGATGCACTCAACCT
TAAATGTACCTAAAAGTCGCTGGAGTGTGGACTGGAGGACACCAAGAGAACATCTCTGTC
AGAGCTATAAATATCAACCACGGAGATGGTGACAGTGATTGGTATTGCGTCGATTTTGAC
TAAGTAGAAAAGTATAGAAATTATGTGAAAAGAAAATATTAAGTTGATATACATGGCGAT
GAAGGTCTATGGTTCGGAAAGTATAATGACCCAGATGTTATCAAAGCAGGGATCAGGATA
AAAAAAGTTATTTAAAGAAAAAATGATATTGTCATTTTAGCTCCTGGAGTTTTGCATTGG
GTACGCTGCAGAGGTAGAAGTGTGTAAACTGCATGGAATTTTGCTTACAGAAGGATTGAA
GACATAATTGCTATGAATGAAAGATTTTTGTATAATTAAAAAATCAACTTTGAAACAATA
ATATTGAATAAATCTCTTTTTATGGATTTACTTAATTTTGAGTACCACAATTTACCTTTG
GAAGTAGCACAGAAATTGCATAGTATTGTCGCTGATTACTATTAGAAAGAATACTAATTT
GAACAAAATTTGACTCACTATCCATTTAAATGTAAGAACTAAGTGATTTTTTATGACTAA
ATGCCTGCTTAGCTTAAACACATCCAAATTTATTACTGCAGCTAAATAGGCTGTGGAAAA
GAAATATTTTGCTATTTCGGTATCCTCCGCTCTGAATTCTAATATCAAGAACCTAACAAT
AGCCTATTCCTTTCTTAAGATTTTTGTGGAAAGTATTTCTGTCCTCTTTGCATTTAGGAA
ATGAAAAAAATTGATGATTCTATAATACTTTTTAGAAAATTTGATCTAAATTCGTTGAAG
ACTTTGTTGAACAGAGTTTATAATTATATTTAGGAAGAAGGAAAGTAATAGTCTCTCTAC
CCTATTTCCGATTTAACCAACATTAGTCACTTCTGTGGTTAAATCGCTAACATAAATGAC
TTTGTTTTTAACAAAGACGTAAGGAGATTAGAGCAAGTTTACATTCCTGATGTCTTCGCC
TCATAGGGAGTCGAAGAAATGTAGAAATTTCAACTAGATTTGTAATCAGGAAGACTTATC
GATTTTATTGAGAAACCTATTATGAAATTTATTGCACCTAACTAGCAGTAGAGATGTCAA
GATATTATGCATGATGGTGAGGATGATTAGGAGAAAGATAGTCAATAAGTTAAGATAGAA
GATGCTGGTAAAAAAGAAGATGATAGTTTGGTTTCTAATAGTCAATAAGTTAAATCAGCT
AATAAGAATAAAGTTCAGTAGTAGCAACAATAATAAATTGCTACTCAATTAACAAACTAA
GAATTAAAAGAAAATTTGAAAAATGGATAGATATAGCAGAAGTAGTTATCTTTGAATTTT
GAATCAGTAGAAAATAACGATTTAAGCCAAAACAAAAATACAAATGTAAATAGTTAATAT
TAATAAAGTGAATTACCAAATAAACCAAATAAACAACAACTTTCATCATTATAAAATAAA
TAGTTTTAAAATGAATTTTAAATTTAAAATCAACTTTGCAACAACTATTCAAAATGCAAC
TTAGAAAATGATTATTAAACTGATTCAAAAAATAACTTTTCTTCTATATCTTCTATTTAA
TAGCAACATGACGATGAAAAATATGCAATATAGTTGCAATAAGAATTGGACTACATGGGT
TCTAAGACTCGCAAATAAAAAAACAATTCTCAGCTCCTCATTTCTCATGATTATGAAATA
TCTTCACTCACTCAATCTTCGAGAGTTCTAAGAGGAGGGAGATCTCTTTGTTCTAAACCT
CCCTCACAAAACTAAAGAAAAAAAGCTCAGTAAAACAAAATCACAAGCTTGAAATCTATA
TCTGAGTCTAATGACAGCTCAAAATAAAGCTCCAAACAGAACCCAAATGAGGCTTAATCA
CCCACTTCATCATCTACTACAATTGGTGTTTCAACAAATTTAGCTAGTCCCTCACTTTAA
GCTCAATAAAATATCAAGACTAAAATAGAACAAACTAATGTATTACCTTCAGATTCTTAA
ATGGTGATAGAAGAATAACCCTCAACACCATAACAATAAATAGATGATGAAAGTAGCTTT
TAATTTTCTTAAAAAATTAATTATAAAATAGTAAGCAGGAGTAACAGCAATTCGTGCAAA
AAAAGCTAATTGAACACACAGACTACTAGCTAGTAAAATAAAACTATTGATGAAAACAAA
AAAATTAAAATCAAAGGCTATATTTCAGATGACGATGATGCTAATGACCAAGAAGAAATA
GAAAAACAAAGAATAAGAAAAGAGCGCGAATAGCAAAGAGTAAAAATGTTGGAATAGTTG
GAAAAAAGTTAAAAAGAGAAAGAATCTGAGACTAAATAAATCACTAAAGAAACTAAATAA
TAAAAAACTCCTTCAAGTGACTATGAAGATAATCCAAATATTTATAAAAGAAGATTAAAC
TTAAAATAAATTACTAATAGCTCAAACTGA


>TTHERM_00185640(protein)
MNLRNKRKVSSSTSEEKDQHFSSSLIQTNENINSNATTSVNIDSTAAYNISQEKEGSPKK
NGLAANSSSTFVSTTDQILINGNNVSKKIKTNSGAAFQTQVSANAPCLKSAEQIIQHQQN
VNNDCDIDCDGFREIFPEDLHTQLQEAIYKEQTIVLREAAGPKGFNVNPKNLFSFESVIK
NHSDMQIDCRVQNPTVYGFNVLNPKNQQHVYNTTIQEYGEYAALLQEDRYEEIKKKPYYK
EYFSKLSNGVMFAVNIDMDDFNWQTENMRLRSGLPHYLLNKGKHDILSYHRQNVMGCTQP
QMYLKVAGVWTGGHQENISVRAININHGDGDSDWYCVDFDQVEKYRNYVKRKYQVDIHGD
EGLWFGKYNDPDVIKAGIRIKKVIQRKNDIVILAPGVLHWVRCRGRSVQTAWNFAYRRIE
DIIAMNERFLYNQKINFETIILNKSLFMDLLNFEYHNLPLEVAQKLHSIVADYYQKEYQF
EQNLTHYPFKCKNQVIFYDQMPAQLKHIQIYYCSQIGCGKEIFCYFGILRSEFQYQEPNN
SLFLSQDFCGKYFCPLCIQEMKKIDDSIILFRKFDLNSLKTLLNRVYNYIQEEGKQQSLY
PISDLTNISHFCGQIANINDFVFNKDVRRLEQVYIPDVFASQGVEEMQKFQLDLQSGRLI
DFIEKPIMKFIAPNQQQRCQDIMHDGEDDQEKDSQQVKIEDAGKKEDDSLVSNSQQVKSA
NKNKVQQQQQQQIATQLTNQELKENLKNGQIQQKQLSLNFESVENNDLSQNKNTNVNSQY
QQSELPNKPNKQQLSSLQNKQFQNEFQIQNQLCNNYSKCNLENDYQTDSKNNFSSISSIQ
QQHDDEKYAIQLQQELDYMGSKTRKQKNNSQLLISHDYEISSLTQSSRVLRGGRSLCSKP
PSQNQRKKAQQNKITSLKSISESNDSSKQSSKQNPNEAQSPTSSSTTIGVSTNLASPSLQ
AQQNIKTKIEQTNVLPSDSQMVIEEQPSTPQQQIDDESSFQFSQKINYKIVSRSNSNSCK
KSQLNTQTTSQQNKTIDENKKIKIKGYISDDDDANDQEEIEKQRIRKEREQQRVKMLEQL
EKSQKEKESETKQITKETKQQKTPSSDYEDNPNIYKRRLNLKQITNSSN


>TTHERM_00185640(gene)
AACAAATTATATTTAAAAATAAATTCAAAAAAAAAATAAATTCTGCGAGAGTTTCGAAAA
CACAAAATTTAAAATAAATCAGCTAACAATTTAATCGTAATACAAACAAGCAGCAATAAA
TAAATAAATTAACAAAAGCAAACAAATAAGTCGATAATTAACAAACAAAGTAGATATCTT
TCTTGCTATATTTTTACTAAGCTAGCTTTAAATTACTTTCTTACTTAATAAAACCTAACT
AACAAAGAACAAACAAGTGAAAGAAAAAATAATCTTTTATTCATAATATTACCTACTTAC
TGTAGCTAAAACATTTATTCAAATTACAAATTATTAAAGAAATAAATAAATAACTTTATC
AAGTCTGAATTTTGTAAAAAGGAATTTAAACCAATCAACATTATTAAGCAAAAAAAAACA
AATAAACAAGCAAAACAAATATATACAAAAGATATTATATCTATATATATTTTTATATAC
ATTTAGATACATAGAATTGATCCAAATTATCTTATGAATCTTAGGAACAAGAGAAAGGTT
TCTTCAAGTACTAGCGAAGAAAAAGACTAACACTTTAGTTCTAGCCTGATTTAAACTAAT
GAAAATATAAATTCGAATGCAACAACTTCGGTCAATATCGATTCTACTGCAGCATACAAT
ATTTCTTAGGAAAAAGAAGGTTCTCCTAAAAAGAATGGATTGGCAGCTAACTCCAGCAGC
ACTTTCGTCTCCACAACTGACTAAATCCTAATAAATGGAAACAACGTATCAAAGAAAATC
AAGACAAATAGCGGTGCTGCATTTCAAACTTAAGTTTCTGCGAATGCTCCTTGCTTAAAA
TCAGCAGAACAAATTATTTAGCATTAGTAGAATGTTAATAATGATTGTGATATTGACTGC
GATGGATTTCGCGAAATATTTCCTGAAGACCTACACACATAGTTGTAGGAAGCAATTTAT
AAAGAATAAACCATCGTTTTGAGAGAAGCAGCTGGCCCTAAAGGTTTTAATGTGAACCCC
AAAAACTTATTTAGCTTTGAAAGTGTGATTAAAAATCATAGCGATATGTAAATTGACTGT
AGAGTTTAAAATCCTACAGTTTATGGCTTTAATGTTTTAAATCCCAAAAACCAATAGCAT
GTCTACAATACCACCATTTAGGAATACGGAGAGTATGCTGCATTGCTTTAAGAAGACAGG
TACGAAGAAATTAAGAAAAAACCATATTACAAAGAATACTTTAGCAAACTATCTAACGGA
GTAATGTTTGCTGTAAACATTGACATGGATGATTTTAATTGGTAAACCGAAAACATGCGT
CTGAGATCAGGGCTTCCCCATTACCTCCTAAATAAAGGCAAACATGATATCCTTAGCTAC
CATAGGTAAAACGTTATGGGATGCACTCAACCTTAAATGTACCTAAAAGTCGCTGGAGTG
TGGACTGGAGGACACCAAGAGAACATCTCTGTCAGAGCTATAAATATCAACCACGGTAAA
TACAAGATTCAATTTACTTTTGATAAATTTATGAATTTATCTAAAATTTTGTTTCCATTA
AGCTTGTTTTTTGATATATATTCTACCTATCCATCCATCCACCAATCCAACAATATAAAT
CCTATCACTCCATCTAAATAATTTTCTTTAGACCAAAAAAGCAAACAAAAAAATAAATAA
ATAAATAAATAATATCTCTCTTCAAATTTAAAGACCATAATAATCAAACAATCTTGATTG
ATTAAATTTTAGTTTATTTTTAAATAACTACTAGCAAAGCTAGAACTTAAAATTGAATCT
TGCATATTTTTGGAAGATTAAATTATCAAAGGTTATTAATTCGCAGTCAGCATAAAAATT
GTTAGTTTTGAATTTGAACATTAATTAGTTGTAAATAATTATCAAGCAAACTTTTGAATT
TTGCTTCCCCCTTTTTATTTCAATTTATTATTAAAGTAAAATTGAAGTCCAAAATAATTA
GTTTCTAAATTCAATTTTGACTTAATATTAATTAGTAAAAATAACTTACAATTTTTGAAC
AATTTTTACTTAATTAATTAATTTACAAGCCTGATTTATTTTGGTCAAATTAATAAAATC
AATAATCAAATTTTAATAAATATTTAAATGTTAATGCAAATAAATATTTTACTTTAAATT
CAAGAGGATATTTTTCAATTAAAAATTTTAATTTAATTACAACATAAATTTATTTAATTA
AAATATTTTTTATTTATTAAATAGGAGATGGTGACAGTGATTGGTATTGCGTCGATTTTG
ACTAAGTAGAAAAGTATAGAAATTATGTGAAAAGAAAATATTAAGTTGATATACATGGCG
ATGAAGGTCTATGGTTCGGAAAGTATAATGACCCAGATGTTATCAAAGCAGGGATCAGGA
TAAAAAAAGTTATTTAAAGAAAAAATGATATTGTAAGTTTAATTTAAAAAGATTAATATG
ATATTTAAATTTTGATTATGATTAATTAATTAGATTTTTAATTTTATAAATTATGCTAAT
TTTATTTTATCATTTAAGGTCATTTTAGCTCCTGGAGTTTTGCATTGGGTACGCTGCAGA
GGTAGAAGTGTGTAAACTGCATGGAATTTTGCTTACAGAAGGATTGAAGACATAATTGCT
ATGAATGAAAGATTTTTGTATAATTAAAAAATCAACTTTGAAACAATAATATTGAATAAA
TCTCTTTTTATGGATTTACTTAATTTTGAGTACCACAATTTACCTTTGGAAGTAGCACAG
AAATTGCATAGTATTGTCGCTGATTACTATTAGAAAGAATACTAATTTGAACAAAATTTG
ACTCACTATCCATTTAAAGTAAAATATTTGAAAAAATTTATATCAAATAACAATTTTTTA
ATGTATTTTTTCAAGTGTAAGAACTAAGTGATTTTTTATGACTAAATGCCTGCTTAGCTT
AAACACATCCAAATTTATTACTGCAGCTAAATAGGCTGTGGAAAAGAAATATTTTGCTAT
TTCGGTATCCTCCGCTCTGAATTCTAATATCAAGAACCTAACAATAGCCTATTCCTTTCT
TAAGATTTTTGTGGAAAGTATTTCTGTCCTCTTTGCATTTAGGAAATGAAAAAAATTGAT
GATTCTATAATACTTTTTAGAAAATTTGATCTAAATTCGTTGAAGACTTTGTTGAACAGA
GTTTATAATTATATTTAGGAAGAAGGAAAGTAATAGTCTCTCTACCCTATTTCCGATTTA
ACCAACATTAGTCACTTCTGTGGTTAAATCGCTAACATAAATGACTTTGTTTTTAACAAA
GACGTAAGGAGATTAGAGCAAGTTTACATTCCTGATGTCTTCGCCTCATAGGGAGTCGTA
ATTTAATCGCTTTAAAAATTTATCAAATTTTATTTTTCTAATTTAGCACATTTATTTCTT
TATTTTAAAAAGGATTTAATTGAAAATTTTTTAATTTTTTAATCAATTTTAATTAGAAAA
TAAAATCTTATTTTATTTTTATCAAAATTTGTTTTCATAATTGATTTATTTGATCAGCAT
TAAAAACAAACAAAAATTTTATTTTCATAATTAGAGTTTTTTAGCAATATAATCAAAATC
AATTATTTAATTTTAAATTAAACACTTTTACTCAAATTTTTAATAAAAAAACCCTTTAAT
TTATTTAATCTACTCAAATAAAATTTAATAAATAATTTTTATCTATTAATTTAAATCCAT
AATTAATAAAGTTTTTTAATGAATTAACTAATTAATTAATTAATTAATTGGTTGTATTTT
TTTTACTAAACAAACAAATTAAAAAAAAGTTAGAATTGTTTTTTGAATTAATATTTTTTA
AATGAGATTTGAGAAAATTTTTATTGGTTTATTTATTGAAAAACTTAAATAATTTATTTG
ATATGATTAGGAAGAAATGTAGAAATTTCAACTAGATTTGTAATCAGGAAGACTTATCGA
TTTTATTGAGAAACCTATTATGAAATTTATTGCACCTAACTAGCAGTAGAGATGTCAAGA
TATTATGCATGATGGTGAGGATGATTAGGAGAAAGATAGTCAATAAGTTAAGATAGAAGA
TGCTGGTAAAAAAGAAGATGATAGTTTGGTTTCTAATAGTCAATAAGTTAAATCAGCTAA
TAAGAATAAAGTTCAGTAGTAGCAACAATAATAAATTGCTACTCAATTAACAAACTAAGA
ATTAAAAGAAAATTTGAAAAATGGATAGATATAGCAGAAGTAGTTATCTTTGAATTTTGA
ATCAGTAGAAAATAACGATTTAAGCCAAAACAAAAATACAAATGTAAATAGTTAATATTA
ATAAAGTGAATTACCAAATAAACCAAATAAACAACAACTTTCATCATTATAAAATAAATA
GTTTTAAAATGAATTTTAAATTTAAAATCAACTTTGCAACAACTATTCAAAATGCAACTT
AGAAAATGATTATTAAACTGATTCAAAAAATAACTTTTCTTCTATATCTTCTATTTAATA
GCAACATGACGATGAAAAATATGCAATATAGTTGCAATAAGAATTGGACTACATGGGTTC
TAAGACTCGCAAATAAAAAAACAATTCTCAGCTCCTCATTTCTCATGATTATGAAATATC
TTCACTCACTCAATCTTCGAGAGTTCTAAGAGGAGGGAGATCTCTTTGTTCTAAACCTCC
CTCACAAAACTAAAGAAAAAAAGCTCAGTAAAACAAAATCACAAGCTTGAAATCTATATC
TGAGTCTAATGACAGCTCAAAATAAAGCTCCAAACAGAACCCAAATGAGGCTTAATCACC
CACTTCATCATCTACTACAATTGGTGTTTCAACAAATTTAGCTAGTCCCTCACTTTAAGC
TCAATAAAATATCAAGACTAAAATAGAACAAACTAATGTATTACCTTCAGATTCTTAAAT
GGTGATAGAAGAATAACCCTCAACACCATAACAATAAATAGGTAAATAAATATGATTGAT
TTTAACCAAATACTAACTAACAAACAAACTAAATAATTCATGATGAAATTAATATTAGAA
AAATGAATTTAAATTTTTTTAAAATTAGATGATGAAAGTAGCTTTTAATTTTCTTAAAAA
ATTAATTATAAAATAGTAAGCAGGAGTAACAGCAATTCGTGCAAAAAAAGCTAATTGAAC
ACACAGACTACTAGCTAGTAAAATAAAACTATTGATGAAAACAAAAAAATTAAAATCAAA
GGCTATATTTCAGATGACGATGATGCTAATGACCAAGAAGAAATAGAAAAACAAAGAATA
AGAAAAGAGCGCGAATAGCAAAGAGTAAAAATGTTGGAATAGTTGGAAAAAAGTTAAAAA
GAGAAAGAATCTGAGACTAAATAAATCACTAAAGAAACTAAATAATAAAAAACTCCTTCA
AGTGACTATGAAGATAATCCAAATATTTATAAAAGAAGATTAAACTTAAAATAAATTACT
AATAGCTCAAACTGA