Identifiers and Description

Gene Model Identifier

TTHERM_00317260

Standard Name

Ipra1 (Interaction partner of RebL1 and Anqa1)

Aliases

PreTt21026 | 31.m00328 | 3687.m00130

Description

Hypothetical protein. Lacks any recognizable domains. Co-purified with Anqa1 and RebL1.

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.3%

TetraMine Data

TTHERM_00317260

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_08366.19.997093137033517e-262hypothetical protein (877 aa)

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:34086947: Nabeel-Shah S, Garg J, Saettone A, Ashraf K, Lee H, Wahab S, Ahmed N, Fine J, Derynck J, Pu S, Ponce M, Marcon E, Zhang Z, Greenblatt JF, Pearlman RE, Lambert JP, Fillingham J (2021) Functional characterization of RebL1 highlights the evolutionary conservation of oncogenic activities of the RBBP4/7 orthologue in Tetrahymena thermophila. Nucleic acids research ( ):

Sequences

>TTHERM_00317260(coding)
ATGAAAAAAAGCACTCTTTCTTAGTCACCAAATTTAATTCATAAAGAAAACGAATAAACC
AATAAGCCGTAGTTGTCAAACACAATTATTAGAGATTCATTTGGATAAGATTTAGCTTAG
CGCATTAAAAAAGCAAAGGACGAAATATTTGTTCAAAGCCATTAACGCAAGGGGAAGGCT
TAAGAAAAAAAGAATTCTTAAAATAATTTTTCTCAACAACAAGAAAACTCATATAAAACA
AAGAATGCGGAATCAAGCAAGAAAAAAGGAGGAAAAAACTCTAATGTAAATGGAGTTCCT
CCTCAAATCGAAAGCGAATAAGAATTAATGTAAGACGAGTTAAATCCTGAATAAAAAGAG
AGTATTTAATATCAAAAAAATAATATGCATTAAGAGAACGAAGAGCACTCTGATTTTAAC
TCGAACTAAATTGAATGTAGTGGATCAGACAGAAACTAAGATGAAGATGATGACCATTTT
ATGAGAGGTTTCATGCCATAAAAAAATCAAGAATTTGGTCAGTAGTTCACAATTTTGGGA
GGAGCTATAGATACTCAAAAGTTCATTAATCTAATATTTAACAAGAACGAAGGAAATCAA
GATACAGATGAACAGTAATAGCAAAAAAAGTAAAATGGCAAAAGGAGAAAATCAAAAAAG
GAAAATGCTTCTGAGATTAAATCTAATGAAAATCTGAATTCATCTTAGAAGATTAGTAAA
TTTAATGCAGATGGAAATACTCAAACAGCTGAGGTGAAGCCTAAAAGAGAGTACAAAAAG
AGAAGTAAAAAAGTTGATACTTCAGATTAGGATGCAATGAAGAATCAAAATGTTAAGTCT
TAAGGAGACGATTTAAAAATGGGAGATAATTAATTAAACACATAAAGCCTTTAAACTTCT
ATTGTATAAAATGCACCTTCATCTAATTCTAATGGCACTACTCCTAAAAATCATATTAGT
AAAAATATTATAATACAAAACTACAAAAGTAGTAATCTGCAATTCACCTAGCATGAAGGC
AATTAGAGTGTGACCAATGAGAATTAAAATAACTCAAATAATATGAATTAACATACTGTA
TCTAATTGCGCTACCGCTGGTGGTTCAAGTTCTACAAAAAAAGGTTTTAGACAATATACA
AAAGAAACAAAATCCATATCTAATTACAACGAAGGCAATAGTCTTATCGATTAAGAAGGA
CTAATTAACCTTTTCCTTTAAGTTTAATAAGGTTTTTAAAGTGATGAAAATTAGAATTAG
TAGTCAAATGAAATCAATCAAAATTTAGGACTTTTATAATCATCTACAAATCATGAAAAT
CCAATTACTTCCACTCCAAATAATACTAAATCAACTAAAAGAAAGCAAAAAGATACCTCA
AAATCAAAGAATAATTAAAATGAAGGAGCATTAAATGATTAAAATGAGCCAAAACAAAAA
TAAAAAGACTTGACAACACCTGCAAAAGGTAACAATTTTCTGTATCAAGAACCTTAGTCT
ATTAATGGTAGAATAAATATGGAGATAGAAAATTTAGGTAGCGAAATATTTGTCAATTAT
TAAAATGAAAATTAAGCACTTTAGGGCACAGCTACCACAGCAACTTCATCATCTTCTAAA
AAATAAAAAATACATAATAATAATGATCTAAAAGAAAAATCTGAAGAAAAACCTCGAAAA
AAATTGAAAGTTAGCCAAGAAGATTTAGGAGATTCAAGCCTTCAATAAACACCTTAGTAG
ATTATATCAAGTTCTGCTAAAAAAACCAGAAAAGAAAAAAAATAAAAAGAATAATAAACT
CCAGAATCTTAAACATTTAAAAATTCTCAAATACTTCAAGTCACTAAAACAGACAAATCT
TTATTAGTGCAGCTTGCACAAACATCTGTAGACACCGAATAAAATGAAATAGAAAAATAA
ATTGAAGAATTCAGTTTTACGAAGGAGGTAAAGAAGAAATTAAACCCAGAAGATAAAAAG
GCAGAAGAAGAACAACTTAAAAATTCAAAAGTTTTTAATATCCTTTGGGAAAAATAATAA
ATTTATAAAAGAAAATTAGAATTATATCAGTTGTCAAGCTTTGAAAGATACTAACAACAT
AAAATATTAGGACAAAAGAATATCAATAAATCTGAATAATTCTACATTCATGGTTAATAA
GTTAAAGATTAAGATGATTCTGAAATAAAATATCAAATCAAAATTCAAACTGATTCTTCT
GAAAATCATCAATAAAATAGTATATAAATTGAAAAATCTGATGATAATCAATAAAAGCAG
CTGAATAGCGAGAAAAAACAAACTGAAAATAGTAACTCTGATTAAAATTTAGAAGTGGAA
AACACTAATAGCTCTCAATAATAAATTAAATCAAACACTCTAATTGAAGAAAAGTAAAGT
GAACCACTAACCAAGATAGAAAGCGAAAATTCTGAATCTAAAAAGCCTTAATAAAAAAAT
GAGAAAGATGACTAAGATAATCGTGACTACACACAAAAATTTTCAGACCTTAAAAATAAA
TTTGTCATGCTGAAATAGTATTTTAAACCTTCTATAATCACAGCTTGA


>TTHERM_00317260(protein)
MKKSTLSQSPNLIHKENEQTNKPQLSNTIIRDSFGQDLAQRIKKAKDEIFVQSHQRKGKA
QEKKNSQNNFSQQQENSYKTKNAESSKKKGGKNSNVNGVPPQIESEQELMQDELNPEQKE
SIQYQKNNMHQENEEHSDFNSNQIECSGSDRNQDEDDDHFMRGFMPQKNQEFGQQFTILG
GAIDTQKFINLIFNKNEGNQDTDEQQQQKKQNGKRRKSKKENASEIKSNENLNSSQKISK
FNADGNTQTAEVKPKREYKKRSKKVDTSDQDAMKNQNVKSQGDDLKMGDNQLNTQSLQTS
IVQNAPSSNSNGTTPKNHISKNIIIQNYKSSNLQFTQHEGNQSVTNENQNNSNNMNQHTV
SNCATAGGSSSTKKGFRQYTKETKSISNYNEGNSLIDQEGLINLFLQVQQGFQSDENQNQ
QSNEINQNLGLLQSSTNHENPITSTPNNTKSTKRKQKDTSKSKNNQNEGALNDQNEPKQK
QKDLTTPAKGNNFLYQEPQSINGRINMEIENLGSEIFVNYQNENQALQGTATTATSSSSK
KQKIHNNNDLKEKSEEKPRKKLKVSQEDLGDSSLQQTPQQIISSSAKKTRKEKKQKEQQT
PESQTFKNSQILQVTKTDKSLLVQLAQTSVDTEQNEIEKQIEEFSFTKEVKKKLNPEDKK
AEEEQLKNSKVFNILWEKQQIYKRKLELYQLSSFERYQQHKILGQKNINKSEQFYIHGQQ
VKDQDDSEIKYQIKIQTDSSENHQQNSIQIEKSDDNQQKQLNSEKKQTENSNSDQNLEVE
NTNSSQQQIKSNTLIEEKQSEPLTKIESENSESKKPQQKNEKDDQDNRDYTQKFSDLKNK
FVMLKQYFKPSIITA


>TTHERM_00317260(gene)
ATGAAAAAAAGCACTCTTTCTTAGTCACCAAATTTAATTCATAAAGAAAACGAATAAACC
AATAAGCCGTAGTTGTCAAACACAATTATTAGAGATTCATTTGGATAAGATTTAGCTTAG
CGCATTAAAAAAGCAAAGGACGAAATATTTGTTCAAAGCCATTAACGCAAGGGGAAGGCT
TAAGAAAAAAAGAATTCTTAAAATAATTTTTCTCAACAACAAGAAAACTCATATAAAACA
AAGGTACTTATTTAAGCTAATTAATTTTCACAACTCAATTATTTAATACTGCACTCATCT
CATAATTTTTATCTTAAATAAAATATTTTTATAAATTCAGAATGCGGAATCAAGCAAGAA
AAAAGGAGGAAAAAACTCTAATGTAAATGGAGTTCCTCCTCAAATCGAAAGCGAATAAGA
ATTAATGTAAGACGAGTTAAATCCTGAATAAAAAGAGAGTATTTAATATCAAAAAAATAA
TATGCATTAAGAGAACGAAGAGCACTCTGATTTTAACTCGAACTAAATTGAATGTAGTGG
ATCAGACAGAAACTAAGATGAAGATGATGACCATTTTATGAGAGGTTTCATGCCATAAAA
AAATCAAGAATTTGGTCAGTAGTTCACAATTTTGGGAGGAGCTATAGATACTCAAAAGTT
CATTAATCTAATATTTAACAAGAACGAAGGTAAAAATTAATTAATTAATTATTCTTATAA
TCTAGCTAGATTAGAACTTAGAAACATAATTAAATAAATCAATACGTACATACATACATA
AAAACAGACAGACAAACATAGATGCAAAATCATACTAAATTTCATGTTTTAATTAATTAT
AATAAACAAAAATTTTATATAGGAAATCAAGATACAGATGAACAGTAATAGCAAAAAAAG
TAAAATGGCAAAAGGAGAAAATCAAAAAAGGAAAATGCTTCTGAGATTAAATCTAATGAA
AATCTGAATTCATCTTAGAAGATTAGTAAATTTAATGCAGATGGAAATACTCAAACAGCT
GAGGTGAAGCCTAAAAGAGAGTACAAAAAGAGAAGTGTAAGTAGTATTAAATAATATTTT
TTCCAAAGGCATATAACTTATTTTTTACTGAAATATTTATTATGTATAGTTAATCAATAG
ATAGATTTATTGATATATTAATCAATTAATTAATTAATCAATCAGTCAATCAATCAATCA
CCAGTGTTTCTCTTTTGATAATTTAAAATATAGAGATACAATCTATTTTCAATTGAAATA
ATAAAAAACATAAACTGTGATAATTTATTTATTTAGATATTTTTATTAAGAAAAAAGTTG
ATACTTCAGATTAGGATGCAATGAAGAATCAAAATGTTAAGTCTTAAGGAGACGATTTAA
AAATGGGAGATAATTAATTAAACACATAAAGCCTTTAAACTTCTATTGTATAAAATGCAC
CTTCATCTAATTCTAATGGCACTACTCCTAAAAATCATATTAGTAAAAATATTATAATAC
AAAACTACAAAAGTAGTAATCTGCAATTCACCTAGCATGAAGGCAATTAGAGTGTGACCA
ATGAGAATTAAAATAACTCAAATAATATGAATTAACATACTGTATCTAATTGCGCTACCG
CTGGTGGTTCAAGTTCTACAAAAAAAGGTTTTAGACAATATACAAAAGAAACAAAATCCA
TATCTAATTACAACGAAGGCAATAGTCTTATCGTAAGCTAACTTAAAGGCGAAATAAAAT
TATTTAATTTATATTTTATTAATAAAATAGGATTAAGAAGGACTAATTAACCTTTTCCTT
TAAGTTTAAGTAAATTTATTATTTTATAAGAATTTTTAGCTTATAATTACAATTTTTTTA
AATAATTCAGTAAGGTTTTTAAAGTGATGAAAATTAGAATTAGTAGTCAAATGAAATCAA
TCAAAATTTAGGACTTTTATAATCATCTACAAATCATGAAAATCCAATTACTTCCACTCC
AAATAATACTAAATCAACTAAAAGAAAGCAAAAAGATACCTCAAAATCAAAGAATAATTA
AAATGAAGGAGCATTAAATGATTAAAATGAGCCAAAACAAAAATAAAAAGACTTGACAAC
ACCTGCAAAAGGTAACAATTTTCTGTATCAAGAACCTTAGTCTATTAATGGTAGAATAAA
TATGGAGATAGAAAATTTAGGTAGCGAAATATTTGTCAATTATTAAAATGAAAATTAAGC
ACTTTAGGGCACAGCTACCACAGCAACTTCATCATCTTCTAAAAAATAAAAAATACATAA
TAATAATGATCTAAAAGAAAAATCTGAAGAAAAACCTCGAAAAAAATTGAAAGTTAGCCA
AGAAGATTTAGGAGATTCAAGCCTTCAATAAACACCTTAGTAGATTATATCAAGTTCTGC
TAAAAAAACCAGAAAAGAAAAAAAATAAAAAGAATAATAAACTCCAGAATCTTAAACATT
TAAAAATTCTCAAATACTTCAAGTCACTAAAACAGACAAATCTTTATTAGTGCAGCTTGC
ACAAACATCTGTAGACACCGAATAAAATGAAATAGAAAAATAAAGTAACTTAAATATTTA
CATTAGATATAAAGTAATTTTTTATTAAAATATTAATAATAGTTGAAGAATTCAGTTTTA
CGAAGGAGGTAAAGAAGAAATTAAACCCAGAAGATAAAAAGGCAGAAGAAGAACAACTTA
AAAATTCAAAAGTTTTTAATATCCTTTGGGAAAAATAATAAATTTATAAAAGAAAATTAG
AATTATATCAGTTGTCAAGCTTTGAAAGATACTAACAACATAAAATATTAGGACAAAAGA
ATATCAATAAATCTGAATAATTCTACATTCATGGTTAATAAGTTAAAGATTAAGATGATT
CTGAAATAAAATATCAAATCAAAATTCAAACTGATTCTTCTGAAAATCATCAATAAAATA
GTATATAAATTGAAAAATCTGATGATAATCAATAAAAGCAGCTGAATAGCGAGAAAAAAC
AAACTGAAAATAGTAACTCTGATTAAAATTTAGAAGTGGAAAACACTAATAGCTCTCAAT
AATAAATTAAATCAAACACTCTAATTGAAGAAAAGTAAAGTGAACCACTAACCAAGATAG
AAAGCGAAAATTCTGAATCTAAAAAGCCTTAATAAAAAAATGAGAAAGATGACTAAGATA
ATCGTGACTACACACAAAAATTTTCAGACCTTAAAAATAAATTTGTCATGCTGAAATAGT
ATTTTAAACCTTCTATAATCACAGCTTGA