Identifiers and Description

Gene Model Identifier

TTHERM_00550910

Standard Name

ITU3 (Iota-TUbulin)

Aliases

PreTt29199 | 72.m00122

Description

Iota-tubulin

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Biological Process

Domains

  • ( PF03637 ) Mob1/phocein family
  • ( PF00091 ) Tubulin/FtsZ family, GTPase domain
  • ( PF03953 ) tubulin/FtsZ family, C-terminal domain

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00550910

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_07346.11.0002211124116698e-173tubulin/FtsZ family, GTPase do
main-containing protein (438 a
a)
SGDYFL037W1.0000099287337047e-53TUB2 Beta-tubulin; associates
with alpha-tubulin (Tub1p and
Tub3p) to form tubulin dimer,
which polymerizes to form micr
otubules
DictyBaseDDB_G02691961.9998745702418095e-48tubB on chromosome: 1 position
3261649 to 3263130
OxytrichaContig8449.0.g13.9991604984848653e-48Tubulin/FtsZ family, GTPase do
main
WormBaseWBGene000065382.99915080840225e-45locus:tbb-4 Tubulin beta-4 c
hain status:Partially_confir
med UniProt:P41937 protein
_id:CAA86310.1
Stentor CoeruleusSteCoe_248535.242885663363464e-22

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:16933976: Eisen JA, Coyne RS, Wu M, Wu D, Thiagarajan M, Wortman JR, Badger JH, Ren Q, Amedeo P, Jones KM, Tallon LJ, Delcher AL, Salzberg SL, Silva JC, Haas BJ, Majoros WH, Farzad M, Carlton JM, Smith RK, Garg J, Pearlman RE, Karrer KM, Sun L, Manning G, Elde NC, Turkewitz AP, Asai DJ, Wilkes DE, Wang Y, Cai H, Collins K, Stewart BA, Lee SR, Wilamowska K, Weinberg Z, Ruzzo WL, Wloga D, Gaertig J, Frankel J, Tsao CC, Gorovsky MA, Keeling PJ, Waller RF, Patron NJ, Cherry JM, Stover NA,

Sequences

>TTHERM_00550910(coding)
ATGTCAGTTATTTCTATCGCAACTGGCAAATGTGGAATTTCGATTTAAGAAAAAGCGTGG
ATTACTCTTCTAAAAGAGTAGGGAATAAATGAAGAGGGATTTATAGAATGCTAAAATACT
CACTAAGGAATAAATGTTTATTTTGAAGAAGTTAAGTAAGATGTTTATAAACCTAGATCA
ATAATTGCAGATTTGGATGACTAAGAAATTAATAGAGTTTAAAATGGATTTTTAAAGAGG
TTATTTTAAAGCAATACAAGCTTTTCAAAATAGGAAAGTAGCCAAAACATTTTTCCTAGA
GGTTACTATAGTCATGGAGCAGAATTAAAAGAAGAAATAGAATATGAGATATAAAAATAA
GTAGAGGTTTGTGATAAAGTAGATTCTATATAGGTATAGAGGTCTTTATGTGGAGGAGCA
GGCTCAGGTTTAGGAAATGTGATTTCTGATATTATTATGGACAATTATTTTTCATAGATA
ATACATAATACTTTGGTACAGCTTCCAGATATTAAGGATGAAAATAGTTGGAATACTTTA
GAGATATACAACACAATTTTATCTCTTCATTCTTTAGTGATATCAGATATTGTTATACCT
TTTTGCAATTCGAATATTTCTAATATGAATTAAAATTCTTTCTAATTGCAAAAATAATTT
AATTTTGATACAATAAATAATGTAGTTTCTCAAATACAGCCAAATTTTACTTGTGGAATT
AGATATCCTGGATCAATTAATGCAAGTTCAAGAAAGATATGTACTAACTTGGTTCCATTT
GCAAGAGTTAAAATGATGACAGCAACATTTCTTCCATTCAATTATTTTCGATAGAATTAG
ATAAGTTAACTAGAATTGACTGATATGATTCCTTAGACGTTGAATGAGAAGAATTTTTTT
TTTGGGTATGGAAATCCTAGCATTATTACTTCACGTCATATTTTTAGAAGTTCTAATATA
TTTGAAGAGGAATTAGAATTATAATTAGTGAAACTATATTAAAAATAAGAAATTCCTGCA
TGGCTGCCTAATTCATATTCTTTTTAGTACTGCAAAGTTTCTTCTGCTTTGAACAAAAAT
TAAATTCTAACCCTAATTCTGAATAGGAATATATATATTTAACTGCAAATCTATAAAAAA
AAATTCGATGAAATGCTTAAAAAAAGAGCATTTATTCATCATTATCTTCAAGAAGGAATG
GATGAAATGGAATTTTAAGAAGCAAAATATAACACTGCTGATTTAATAACGGAATACTAA
ATCCTTAGCTCATTTGATGGAGGTTAAGAAGAATGA


>TTHERM_00550910(protein)
MSVISIATGKCGISIQEKAWITLLKEQGINEEGFIECQNTHQGINVYFEEVKQDVYKPRS
IIADLDDQEINRVQNGFLKRLFQSNTSFSKQESSQNIFPRGYYSHGAELKEEIEYEIQKQ
VEVCDKVDSIQVQRSLCGGAGSGLGNVISDIIMDNYFSQIIHNTLVQLPDIKDENSWNTL
EIYNTILSLHSLVISDIVIPFCNSNISNMNQNSFQLQKQFNFDTINNVVSQIQPNFTCGI
RYPGSINASSRKICTNLVPFARVKMMTATFLPFNYFRQNQISQLELTDMIPQTLNEKNFF
FGYGNPSIITSRHIFRSSNIFEEELELQLVKLYQKQEIPAWLPNSYSFQYCKVSSALNKN
QILTLILNRNIYIQLQIYKKKFDEMLKKRAFIHHYLQEGMDEMEFQEAKYNTADLITEYQ
ILSSFDGGQEE


>TTHERM_00550910(gene)
ATGTCAGTTATTTCTATCGCAACTGGCAAATGTGGAATTTCGATTTAAGAAAAAGCGTGG
ATTACTCTTCTAAAAGAGTAGGGAATAAATGAAGAGGGATTTATAGAATGCTAAAATACT
CACTAAGGAATAAATGTTTATTTTGAAGAAGTTAAGTAAGATGTTTATAAACCTAGATCA
ATAATTGCAGATTTGGATGACTAAGAAATTAATAGAGTTTAAAATGGATTTTTAAAGAGG
TTATTTTAAAGCAATACAAGCTTTTCAAAATAGGAAAGTAGCCAAAACATTTTTCCTAGA
GGTTACTATAGTCATGGAGCAGAATTAAAAGAAGAAATAGAATATGAGATATAAAAATAA
GTAGAGGTTTGTGATAAAGTAGATTCTATATAGGTATAGAGGTCTTTATGTGGAGGAGCA
GGCTCAGGTTTAGGAAATGTGATTTCTGATATTATTATGGACAATTATTTTTCATAGATA
ATACATAATACTTTGGTACAGCTTCCAGATATTAAGGATGAAAATAGTTGGAATACTTTA
GAGATATACAACACAATTTTATCTCTTCATTCTTTAGTGATATCAGATATTGTTATACCT
TTTTGCAATTCGAATATTTCTAATATGAATTAAAATTCTTTCTAATTGCAAAAATAATTT
AATTTTGATACAATAAATAATGTAGTTTCTCAAATACAGCCAAATTTTACTTGTGGAATT
AGATATCCTGGATCAATTAATGCAAGTTCAAGAAAGATATGTACTAACTTGGTTCCATTT
GCAAGAGTTAAAATGATGACAGCAACATTTCTTCCATTCAATTATTTTCGATAGAATTAG
ATAAGTTAACTAGAATTGACTGATATGATTCCTTAGACGTTGAATGAGAAGAATTTTTTT
TTTGGGTATGGAAATCCTAGCATTATTACTTCACGTCATATTTTTAGAAGTTCTAATATA
TTTGAAGAGGAATTAGAATTATAATTAGTGAAACTATATTAAAAATAAGAAATTCCTGCA
TGGCTGCCTAATTCATATTCTTTTTAGTACTGCAAAGTTTCTTCTGCTTTGAACAAAAAT
TAAATTCTAACCCTAATTCTGAATAGGAATATATATATTTAACTGCAAATCTATAAAAAA
AAATTCGATGAAATGCTTAAAAAAAGAGCATTTATTCATCATTATCTTCAAGAAGGAATG
GATGAAATGGAATTTTAAGAAGCAAAATATAACACTGCTGATTTAATAACGGAATACTAA
ATCCTTAGCTCATTTGATGGAGGTTAAGAAGAATGA