Identifiers and Description

Gene Model Identifier

TTHERM_01001250

Standard Name

ITU2 (Iota-TUbulin)

Aliases

PreTt15745 | 190.m00055 | 3820.m00278

Description

Iota-tubulin

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Biological Process

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 13.2%

TetraMine Data

TTHERM_01001250

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_07346.14.0003031991288476e-163tubulin/FtsZ family, GTPase do
main-containing protein (438 a
a)
SGDYFL037W6.000034430729774e-56TUB2 Beta-tubulin; associates
with alpha-tubulin (Tub1p and
Tub3p) to form tubulin dimer,
which polymerizes to form micr
otubules
WormBaseWBGene000065385.0007856079333316e-54locus:tbb-4 Tubulin beta-4 c
hain status:Partially_confir
med UniProt:P41937 protein
_id:CAA86310.1
OxytrichaContig12717.0.g752.9994376937714457e-52Tubulin/FtsZ family, GTPase do
main
DictyBaseDDB_G02691963.9991604984848653e-48tubB on chromosome: 1 position
3261649 to 3263130
Stentor CoeruleusSteCoe_57192.6102790696677047e-23

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:16933976: Eisen JA, Coyne RS, Wu M, Wu D, Thiagarajan M, Wortman JR, Badger JH, Ren Q, Amedeo P, Jones KM, Tallon LJ, Delcher AL, Salzberg SL, Silva JC, Haas BJ, Majoros WH, Farzad M, Carlton JM, Smith RK, Garg J, Pearlman RE, Karrer KM, Sun L, Manning G, Elde NC, Turkewitz AP, Asai DJ, Wilkes DE, Wang Y, Cai H, Collins K, Stewart BA, Lee SR, Wilamowska K, Weinberg Z, Ruzzo WL, Wloga D, Gaertig J, Frankel J, Tsao CC, Gorovsky MA, Keeling PJ, Waller RF, Patron NJ, Cherry JM, Stover NA,

Sequences

>TTHERM_01001250(coding)
ATGTCTAGTATTGTTTCAATTGCAATAGGATAATGTGGTATTTCAATATAAGAAAAACAA
TGGATAACTCTGCTTTAAGAGTATGGGATTGATGAATGCGGAATAATCAATAAATTGGAA
AATGATAAAAAATTAGACTCATATTTTTATGAAGTAAAAGAAAACGTTTACAAGCCTAGA
GCTCTTTTTACAGATTTAGATGATCATCGTATTAATTCCTTGCAGAGTGCTAGTCTAAAA
TAACTATTTTAAGGAGTACCGACAGTTTATTCAATTGATGGTAGTCATAATCTGTTTGCA
AGGGGAATGTATTCAGTAGGAAGTGAATTAAAAGATGAAATTTAAAACTAAATTACATAT
TTATTAGAATAATGTGACAGTGTAGACTCTATCTAAATTTAAAACTCGCTATACGGAGGG
ACAGGTTCTGGATTAGGTGGTTTAATATATGATATACTAAATGAGGTTGCTCCATAATAC
ATAACTAACAATCTTGTGTAATATCCAGATTTAAGTACATAAAGCTAAATGACACTAGAA
ATTTATAATAATATTCTGGGTTAAAATAAATAAGCTCATTTAACATTAATTTTACCCTTT
TGTAACTAAAATATATAGTTTTTGAATGATGGCTCATATAAAATTTAAAAATAAAAAGGA
TTTGACAATATAAATAATGTTATATCACAAATTCACCCACTCATCACTAGTGGATCGAGA
TATCATGGCTCAATTAATGCAAGCACTAGAAAAATATGTACAAATATAATACCTTTTCCA
AGATTAAAACATATGAGTATGATCTGCTTACCTCTTAATTATTACAAATAAAAATAGTAA
ACATAATTAGATTATATAGAAATGATACATGATAGTGTTAATTAAGAATATTCTTTTTTC
AGTAAGGATACATTTAGAATACTGTGTTCTCATCATATGATACGGGGAGTTGATATTCAT
TAAGAAGAAATAGAATCAGAGTATAATAAATTATACAGATCAAATAATATTTTTGCAACA
AATTGGATACCAAATTCTTGCTCAATTTCTTATTGCAATGTTCCATGTCAATACAATTCA
AAATTAATTTTTTCTATAATTTCAAATTACAATATATGTAGGCACTTTGAAAAATACACT
TAATAATATTCATAACTATTTAGAAGAAAGGCATATTTGCATTACTATCTATAAGAAGGT
ATGGATGAAATGGAGTTTACAGAAGCAGAATCAAATATTAATGATGTAATTTGTGATTAT
TAGGCATCTGGATATTATGAAAATGTTGTTGAAGAAGATAATCATGATGATGATGATCAA
TATATGTTAAATTATTTTGATTGA


>TTHERM_01001250(protein)
MSSIVSIAIGQCGISIQEKQWITLLQEYGIDECGIINKLENDKKLDSYFYEVKENVYKPR
ALFTDLDDHRINSLQSASLKQLFQGVPTVYSIDGSHNLFARGMYSVGSELKDEIQNQITY
LLEQCDSVDSIQIQNSLYGGTGSGLGGLIYDILNEVAPQYITNNLVQYPDLSTQSQMTLE
IYNNILGQNKQAHLTLILPFCNQNIQFLNDGSYKIQKQKGFDNINNVISQIHPLITSGSR
YHGSINASTRKICTNIIPFPRLKHMSMICLPLNYYKQKQQTQLDYIEMIHDSVNQEYSFF
SKDTFRILCSHHMIRGVDIHQEEIESEYNKLYRSNNIFATNWIPNSCSISYCNVPCQYNS
KLIFSIISNYNICRHFEKYTQQYSQLFRRKAYLHYYLQEGMDEMEFTEAESNINDVICDY
QASGYYENVVEEDNHDDDDQYMLNYFD


>TTHERM_01001250(gene)
ATGTCTAGTATTGTTTCAATTGCAATAGGATAATGTGGTATTTCAATATAAGAAAAACAA
TGGATAACTCTGCTTTAAGAGTATGGGATTGATGAATGCGGAATAATCAATAAATTGGAA
AATGATAAAAAATTAGACTCATATTTTTATGAAGTAAAAGAAAACGTTTACAAGCCTAGA
GCTCTTTTTACAGATTTAGATGATCATCGTATTAATTCCTTGCAGAGTGCTAGTCTAAAA
TAACTATTTTAAGGAGTACCGACAGTTTATTCAATTGATGGTAGTCATAATCTGTTTGCA
AGGGGAATGTATTCAGTAGGAAGTGAATTAAAAGATGAAATTTAAAACTAAATTACATAT
TTATTAGAATAATGTGACAGTGTAGACTCTATCTAAATTTAAAACTCGCTATACGGAGGG
ACAGGTTCTGGATTAGGTGGTTTAATATATGATATACTAAATGAGGTTGCTCCATAATAC
ATAACTAACAATCTTGTGTAATATCCAGATTTAAGTACATAAAGCTAAATGACACTAGAA
ATTTATAATAATATTCTGGGTTAAAATAAATAAGCTCATTTAACATTAATTTTACCCTTT
TGTAACTAAAATATATAGTTTTTGAATGATGGCTCATATAAAATTTAAAAATAAAAAGGA
TTTGACAATATAAATAATGTTATATCACAAATTCACCCACTCATCACTAGTGGATCGAGA
TATCATGGCTCAATTAATGCAAGCACTAGAAAAATATGTACAAATATAATACCTTTTCCA
AGATTAAAACATATGAGTATGATCTGCTTACCTCTTAATTATTACAAATAAAAATAGTAA
ACATAATTAGATTATATAGAAATGATACATGATAGTGTTAATTAAGAATATTCTTTTTTC
AGTAAGGATACATTTAGAATACTGTGTTCTCATCATATGATACGGGGAGTTGATATTCAT
TAAGAAGAAATAGAATCAGAGTATAATAAATTATACAGATCAAATAATATTTTTGCAACA
AATTGGATACCAAATTCTTGCTCAATTTCTTATTGCAATGTTCCATGTCAATACAATTCA
AAATTAATTTTTTCTATAATTTCAAATTACAATATATGTAGGCACTTTGAAAAATACACT
TAATAATATTCATAACTATTTAGAAGAAAGGCATATTTGCATTACTATCTATAAGAAGGT
ATGGATGAAATGGAGTTTACAGAAGCAGAATCAAATATTAATGATGTAATTTGTGATTAT
TAGGCATCTGGATATTATGAAAATGTTGTTGAAGAAGATAATCATGATGATGATGATCAA
TATATGTTAAATTATTTTGATTGA