Identifiers and Description

Gene Model Identifier

TTHERM_00370900

Standard Name

IRS1 (Isoleucyl-tRNA synthetase 1)

Aliases

PreTt28606 | 39.m00179 | 3693.m00026

Description

Isoleucyl-tRNA synthetase

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.3%

TetraMine Data

TTHERM_00370900

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_12245.19.997093137033517e-262isoleucyl-tRNA synthetase (117
8 aa)
DictyBaseDDB_G02930304.001287313050914e-66mileS on chromosome: 6 positio
n 2348091 to 2351327
OxytrichaContig11813.0.g681.0003503620230312e-57tRNA synthetases class I (I, L
, M and V)
SGDYPL040C1.9998323414791308e-36ISM1 Mitochondrial isoleucyl-t
RNA synthetase, null mutant is
deficient in respiratory grow
th
WormBaseWBGene000021535.999781043483669e-32locus:iars-2 status:Confirme
d UniProt:E2JL04 protein_i
d:CBX25138.1

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00370900(coding)
ATGATTAGGTTTTGCCTTAGAACTGGCATTTAGCAGTATTTGTATAATTAGAATTAGTTA
TTTAGGTTTGCAAGAAAACAAACTCCCCAACAGTAAAAGAGAAAGAATCTAATTGCTGAT
GATGTTGAATAAGATGGAAAAAATGATTAAGTTTTTAGTGAAAGTGATAACGAAGAAATA
GAATACCAAGAATAAAGAGGAAATAATCAAACTTATAAATCTAAGAATAATGAATTAGTT
ATTCAGAAAAATGATCTGATGCTTCATATTCCAAAAACTGAATTTAATCCTCGTTTCAAG
CCAACTCTTAATGAAGAAAGATATCATAATAAAATAGCTCAAAATTTATACTTATGGTAA
TAAGCTAACAAAAATAATCCTGAAAAACAGTATGTTATTCATGATTTACCATTCTTAACT
TATGGCGAACCTCATTTAGGACATTTCTACAATAAAACTCAGTAAGATATTGCAGCAAGA
TTTGCAATGCTAAACGGATATAAAGTAACTCATCAAATAGGCTTTAATCTCCATGGTTAA
ACTATATAAAACTAAGCAGTTATTGCAGAGTAGCTGAAAACTAAAGAATTAAAGAGATTC
AGCTCCTAAGAAATCAGAGATATATCAAACAATTTTGCCTATGAGAGCTTAAAAAATATT
ATCATAAAAATGTCTCGTTGGGGTTTAATGACTGATTTTTCTCAAGCTTATACTACTAAC
CATCCTTTTTACGAAAGTGGTGTACTCAAAGCATTTTACGAGCTAGTTTAAGAAAAAAGC
ATTTTCTTAGATGAAAAGCCAACTTTGTGGTCAGTCAAAAACAGAACTGCCTTAGACGAT
GATGAAGCTAACATGGAAATTATTCCTAAACCCGGAACATTTATTAAATTTGAAGTGAAA
AACTTTGGAAACAATATTTTCCTGTAAAATTTAGCTTAAGAACATCAAGTTAAAGTTTAT
GTTATTGGTTTCACTACTGAATTGTGGACCTTAAATTCTTTAAGAGCGCTTTCAGTCAAT
GAAAATGTTTAATATGGTATATATAAATCAGGAGATGCACTTTATGTTATTTCTAGAAAC
AGATTTAAGCATCACCGTCTTTTTTTTAAGGAAGAAAATAAGGGAACACTTGTTTCTACA
TAAACAGGAAAATAAATATCATAACTTACAGTATTTGATCAAGCTTTTGAAAGGGATATT
CCAGTTTTAAGCTGTGATACTTATGCTAAAAATGAAAGATTTGGATTAGGTATTGCTTGT
GTATGCCCTGGTCATTATTCTAAAGACTTTTAAGTTTCTGAGTAGTATGATTTGAGCAAA
AAAGCGCATGTTAATAAATTTGGTAGATTAGATTAAACAGTTCCTAATGATTTATAAAAT
CTTAGTGTAGTTAATGGTGAAGCAGATGAGCATATACTATAAAAATACTTAGATCAGAAT
TTGGTTCTAGACATTGATGAAAACTATGAAACAGAGTAGTATTTTGATAAAAAAACTAAT
GAAAAATTAATAGTAAGAACTTAAATGACTGTTTACTCGAGGTTACCAGATTTTGAAAGA
GAATATTTTGTTGAGCAACTTAAAGAGAAAATTAAAATTAAGATTAGCGGATAGCTATCA
AATAAAGAAAGTTAATCAGAAAGCTAAGAGGGTGCTTTTGGTTCTCTAGAAAAATAAATC
TTAGAAAAGTCTGACAACTGGACTATTTCTTCAAATCAAGAATGGGGCATTCCAATTCCT
ATCTTCTTTTACATAAATACCAATCAGTAAAAGTATCTATTAGAACCTGCAGTTGTGAAA
CATATTATTGGGCTCTATGAATAATTTGGAAGCTAAATTTGGCATCAATATTCAATAGAA
GAGCTTTTACCATAGAAATATAAGAATTTAGCAGCTCAATTAGAGAAAGGGTAATTTACA
TTTGATTAATGGTTTGAAAGTGGATGCAGTTGGTATGTAATGCTTAAAAGTAAACCTAAT
GGTTAAGATATTAGACAAAAGTTTTTGATTTAATAAAATGATTTAATTAAATAAAAGCAG
AAATAATTATCTATTGAGAATAAAGATTAAGATTAATCAAAATAAATTGTTTCTTCATCA
AGCTAATCAAGTTAAGCAAGCTCTGGAGAATTTAACATAGTTCAAAAATATCCATGTGAC
TTAGCTATTTAGGGTAAAGATCAAATTGATAGTTGGTTATTGTCAACTTCTTTACTGTCA
ATTGGATTAAAAGAGCATGCCTTTTTTAATAATTTGAAGCTTCATAGAGTTATCCCTGCA
ACTAATGATGAAAAATTATCTAAATTATCATAATTTAAGAGCAGTATAGATGATTATATT
GAAGGAACAGTTAAATTAAATGGGGAAAGATAGTACGGATACGGAGTTGATATCCTTAGA
ATGTGGGTTGCTCTTTCAGATAAAGTTAGAGAATAAGTTAATGATAAAAAAAAGAAAAAA
GAAAAAAATGAAAATGCTATTTAAGTAGCTGAAAATATGGACTACATATTTATGAGACCA
AACGAATTCGATGTACCAAATAATTATATTAACATTTTCAGAAAATGTATGTGGAATATG
TTAGGTAGTTTGAAAGGATATAATTAAAATCTTGAATAAATAAAAATATTCAATAATGGA
AAACTTTCATTCTTAAGCGATTACATGATGACATAATTAGTTCTTTATATGATAAACATG
CATAGAGCTTATTAGCAACTCGATTACGCTACTAATGTAGATTTAACTATGGACTTCATT
AAAAATTGGGTTTATGATTTCTTCTTGGATTCTACTAAAAACTTTATAATTTCTAATCCA
GTTGATCCTAAAACTTAAGAATATCTTTTTGTTTACTCTAAGATAGTAGAAAACCTTTTA
ATAGCAGTTTCCCCTATGATCCCTCATAACGCAGAAGATATTTTTAGTAATGTGCACTTT
AAATTAAATAAAAAAGAATCAATTTTCCATTACGATTGGCCTGATATGAGTAAAGAAGAT
GTCCATTCATTGTAGAGCAAAATCCCAAAATAAAATTTGCTCTGGTAATTAAGAGAGTGT
ATTTGGGAATAATTGACATTTTAAATGGAAAGATATCAAAACATTCGTTCAAAAGAAAGA
TATGATATAGTGATTATAGTTGATGAATTATTTAGTAAAGAGTACTCTATTTTAGAAGAA
ACATGTATAGATGAATTAGATTCCTTTATTGGAGCAGGTTAAGTAAAAGTGCATACTTTG
AAAGAAAATTAGGAATATCCTCACAACTCTATTAGTACATTTAAATTTAAAACAAATTAT
CTAAGTAATGAAAAGCTAAGCTACACTATAAAAATATATTTATCTGAAAACTTTAAGTGT
ATCAGATGCCATAAATATACAGCTATATATGAAAATACTATATGTCCTCACTGCATTACT
TATTTATCTACCAACCATAAGAAGTAATGCAATCATCTACTTAATTAAATAAAAAGAAAT
CCATAATTACCTATTAAAGTTATAGATCCTAAACAAAAAATTCTAGAATGA


>TTHERM_00370900(protein)
MIRFCLRTGIQQYLYNQNQLFRFARKQTPQQQKRKNLIADDVEQDGKNDQVFSESDNEEI
EYQEQRGNNQTYKSKNNELVIQKNDLMLHIPKTEFNPRFKPTLNEERYHNKIAQNLYLWQ
QANKNNPEKQYVIHDLPFLTYGEPHLGHFYNKTQQDIAARFAMLNGYKVTHQIGFNLHGQ
TIQNQAVIAEQLKTKELKRFSSQEIRDISNNFAYESLKNIIIKMSRWGLMTDFSQAYTTN
HPFYESGVLKAFYELVQEKSIFLDEKPTLWSVKNRTALDDDEANMEIIPKPGTFIKFEVK
NFGNNIFLQNLAQEHQVKVYVIGFTTELWTLNSLRALSVNENVQYGIYKSGDALYVISRN
RFKHHRLFFKEENKGTLVSTQTGKQISQLTVFDQAFERDIPVLSCDTYAKNERFGLGIAC
VCPGHYSKDFQVSEQYDLSKKAHVNKFGRLDQTVPNDLQNLSVVNGEADEHILQKYLDQN
LVLDIDENYETEQYFDKKTNEKLIVRTQMTVYSRLPDFEREYFVEQLKEKIKIKISGQLS
NKESQSESQEGAFGSLEKQILEKSDNWTISSNQEWGIPIPIFFYINTNQQKYLLEPAVVK
HIIGLYEQFGSQIWHQYSIEELLPQKYKNLAAQLEKGQFTFDQWFESGCSWYVMLKSKPN
GQDIRQKFLIQQNDLIKQKQKQLSIENKDQDQSKQIVSSSSQSSQASSGEFNIVQKYPCD
LAIQGKDQIDSWLLSTSLLSIGLKEHAFFNNLKLHRVIPATNDEKLSKLSQFKSSIDDYI
EGTVKLNGERQYGYGVDILRMWVALSDKVREQVNDKKKKKEKNENAIQVAENMDYIFMRP
NEFDVPNNYINIFRKCMWNMLGSLKGYNQNLEQIKIFNNGKLSFLSDYMMTQLVLYMINM
HRAYQQLDYATNVDLTMDFIKNWVYDFFLDSTKNFIISNPVDPKTQEYLFVYSKIVENLL
IAVSPMIPHNAEDIFSNVHFKLNKKESIFHYDWPDMSKEDVHSLQSKIPKQNLLWQLREC
IWEQLTFQMERYQNIRSKERYDIVIIVDELFSKEYSILEETCIDELDSFIGAGQVKVHTL
KENQEYPHNSISTFKFKTNYLSNEKLSYTIKIYLSENFKCIRCHKYTAIYENTICPHCIT
YLSTNHKKQCNHLLNQIKRNPQLPIKVIDPKQKILE


>TTHERM_00370900(gene)
ATGATTAGGTTTTGCCTTAGAACTGGCATTTAGCAGTATTTGTATAATTAGAATTAGTTA
TTTAGGTTTGCAAGAAAACAAACTCCCCAACAGTAAAAGAGAAAGAATCTAATTGCTGAT
GATGTTGAATAAGATGGAAAAAATGATTAAGTTTTTAGTGAAAGTGATAACGAAGAAATA
GAATACCAAGAATAAAGAGGAAATAATCAAACTTATAAATCTAAGAATAATGAATTAGTT
ATTCAGAAAAATGATCTGATGCTTCATATTCCAAAAACTGAATTTAATCCTCGTTTCAAG
CCAACTCTTAATGAAGAAAGATATCATAATAAAATAGCTCAAAATTTATACTTATGGTAA
TAAGCTAACAAAAATAATCCTGAAAAACAGTATGTTATTCATGATTTACCATTCTTAACT
TATGGCGAACCTCATTTAGGACATTTCTACAATAAAACTCAGTAAGATATTGCAGCAAGA
TTTGCAATGCTAAACGGATATAAAGTAACTCATCAAATAGGCTTTAATCTCCATGGTTAA
ACTATATAAAACTAAGCAGTTATTGCAGAGTAGCTGAAAACTAAAGAATTAAAGAGATTC
AGCTCCTAAGAAATCAGAGATATATCAAACAATTTTGCCTATGAGAGCTTAAAAAATATT
ATCATAAAAATGTCTCGTTGGGGTTTAATGACTGATTTTTCTCAAGCTTATACTACTAAC
CGTAAAAATATATATTCAAATATTTTAAATAAGATTTACAATTTTTCATATATTGTTTTT
ATTCAATATGTTAAAATAGTTTTCAATCAATATTATTACAAAATAAATATTTTAATTATT
ATTCAAATTTTATTTATTTTTTTAGATCCTTTTTACGAAAGTGGTGTACTCAAAGCATTT
TACGAGCTAGTTTAAGAAAGTAAAACTTTTTCAAGGTTGAAATTATATTTAGTGAGTTTT
AATATTATCAGAAAGCATTTTCTTAGATGAAAAGCCAACTTTGTGGTCAGTCAAAAACAG
AACTGCCTTAGACGATGATGAAGCTAACATGGAAATTATTCCTAAACCCGGAACATTTAT
TAAATTTGAAGTGAAAAACTTTGGAAACAATATTTTCCTGTAAAATTTAGCTTAAGAACA
TCAAGTTAAAGTTTATGTTATTGGTTTCACTACTGAATTGTGGACCTTAAATTCTTTAAG
AGCGCTTTCAGTCAATGAAAATGTTTAATATGGTATATATAAATCAGGAGATGCACTTTA
TGTTATTTCTAGAAACAGATTTAAGCATCACCGTCTTTTTTTTAAGGAAGAAAATAAGGG
AACACTTGTTTCTACATAAACAGGAAAATAAATATCATAACTTACAGTAATTTTAGTTTA
TTTAGATTATAAAAATATATTCATTCATTCATTCATTCATTCATTTTTTAAGGTATTTGA
TCAAGCTTTTGAAAGGGATATTCCAGTTTTAAGCTGTGATACTTATGCTAAAAATGAAAG
ATTTGGATTAGGTATTGCTTGTGTATGCCCTGGTCATTATTCTAAAGACTTTTAAGTTTC
TGAGTAGTATGATTTGAGCAAAAAAGCGCATGTTAATAAATTTGGTAGATTAGATTAAAC
AGTTCCTAATGATTTATAAAATCTTAGTGTAGTTAATGGTGAAGCAGATGAGCATATACT
ATAAAAGTAAAAAGATTTATATTCTCTTTATTTTATTCAAATAGACTTTATTAAATTAGA
ATTAATAACTTTCAACAACATTAATAAATAAATGAGAATAAATAAGTTATTTTAAAACTC
TGAAATTTATTTAATAAATTAATTAAATTCATAGATACTTAGATCAGAATTTGGTTCTAG
ACATTGATGAAAACTATGAAACAGAGTAGTATTTTGATAAAAAAACTAATGAAAAATTAA
TAGTAAGAACTTAAATGACTGTTTACTCGAGGTTACCAGATTTTGAAAGAGAATATTTTG
TTGAGCAACTTAAAGAGAAAATTAAAATTAAGATTAGCGGATAGCTATCAAATAAAGAAA
GTTAATCAGAAAGCTAAGAGGGTGCTTTTGGTTCTCTAGAAAAATAAATCTTAGAAAAGT
CTGACAACTGGACTATTTCTTCAAATCAAGAATGGGGCATTCCAATTCCTATCTTCTTTT
ACATAAATACCAATCAGTAAAAGTATCTATTAGAACCTGCAGTTGTGAAACATATTATTG
GGCTCTATGAATAATTTGGAAGCTAAATTTGGCATCAATATTCAATAGAAGAGCTTTTAC
CATAGAAATATAAGTAAAAAACAATTAAATTTTATCAATGATAAATATATTTTTATTAAT
TAAAGGAATTTAGCAGCTCAATTAGAGAAAGGGTAATTTACATTTGATTAATGGTTTGAA
AGTGGATGCAGTTGGTATGTAATGCTTAAAAGTAAACCTAATGGTTAAGATATTAGACAA
AAGTTTTTGATTTAATAAAATGATTTAATTAAATAAAAGCAGAAATAATTATCTATTGAG
AATAAAGATTAAGATTAATCAAAATAAATTGTTTCTTCATCAAGCTAATCAAGTTAAGCA
AGCTCTGGAGAATTTAACATAGTTCAAAAATATCCATGTGACTTAGCTATTTAGGGTAAA
GATCAAATTGATAGTTGGTTATTGTCAACTTCTTTACTGTCAAGTAATATTAAATTTAAA
TATAATTATTTTATAGCTAAATTTTTAAATAGTTGGATTAAAAGAGCATGCCTTTTTTAA
TAATTTGAAGCTTCATAGAGTTATCCCTGCAACTAATGATGAAAAATTATCTAAATTATC
ATAATTTAAGAGCAGTATAGATGATTATATTGAAGGAACAGTTAAATTAAATGGGGAAAG
ATAGTACGGATACGGAGTTGATATCCTTAGAATGTGGGTTGCTCTTTCAGATAAAGTTAG
AGAATAAGTTAATGATAAAAAAAAGAAAAAAGAAAAAAATGAAAATGCTATTTAAGTAGC
TGAAAATATGGACTACATATTTATGAGACCAAACGAATTCGATGTACCAAATAATTATAT
TAACATTTTCAGAAAATGTATGTGGAATATGTTAGGTAGTTTGAAAGGATATAATTAAAA
TCTTGAATAAATAAAAATATTCAATAATGGAAAACTTTCATTCTTAAGCGATTACATGAT
GACATAATTAGTTCTTTATATGATAAACATGCATAGAGCTTATTAGCAACTCGATTACGC
TACTAATGTAGATTTAACTATGGACTTCATTAAAAATTGGGTTTATGATTTCTTCTTGGA
TTCTACTAAAAACTTTATAATTTCTAATCCAGTTGATCCTAAAACTTAAGAATATCTTTT
TGTTTACTCTAAGGTAAATTTTAATTAACTAATCGAAGCTCATTTTGTTTTATATATTCA
AATAGATAGTAGAAAACCTTTTAATAGCAGTTTCCCCTATGATCCCTCATAACGCAGAAG
ATATTTTTAGTAATGTGCACTTTAAATTAAATAAAAAAGAATCAATTTTCCATTACGATT
GGCCTGATATGGTAAATAATTATTTTAAAAATTAATTTATTATTGAATGATATATATTAT
TTAAAGAGTAAAGAAGATGTCCATTCATTGTAGAGCAAAATCCCAAAATAAAATTTGCTC
TGGTAATTAAGAGAGTGTATTTGGGAATAATTGACATTTTAAATGGAAAGATATCAAAAC
ATTCGTTCAAAAGAAAGATATGATATAGTGATTATAGTTGATGAATTATTTAGTAAAGAG
TACTCTATTTTAGAAGAAACATGTATAGATGAATTAGATTCCTTTATTGGAGCAGGTTAA
GTAAAAGTGCATACTTTGAAAGAAAATTAGGAATATCCTCACAACTCTATTAGTACATTT
AAATTTAAAACAAATTATCTAAGTAATGAAAAGCTAAGCTACACTATAAAAATATATTTA
TCTGAAAACTTTAAGTGTATCAGATGCCATAAATATACAGCTATATATGAAAATACTATA
TGTCCTCACTGCATTACTTATTTATCTACCAACCATAAGAAGTAATGCAATCATCTACTT
AATTAAATAAAAAGAAATCCATAATTACCTATTAAAGTTATAGATCCTAAACAAAAAATT
CTAGAATGA