Identifiers and Description

Gene Model Identifier

TTHERM_00641080

Standard Name

IRE1 (Inositol REquiring)

Aliases

PreTt10577 | 92.m00119

Description

Serine/Threonine kinase domain protein; Homolog of yeast IRE1; Protein kinase domain containing protein. Sequence similarity to the IRE protein kinase family (Eisen et al.- 2006).

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( PF04383 ) KilA-N domain
  • ( PF06479 ) Ribonuclease 2-5A
  • ( PF00069 ) protein kinase domain
  • ( PF07714 ) protein tyrosine kinase
  • ( PF05316 ) Mitochondrial ribosomal protein (VAR1)

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 18.3%

TetraMine Data

TTHERM_00641080

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_05206.19.997093137033517e-262protein kinase domain-containi
ng protein (920 aa)
WormBaseWBGene000021471.9997677415930956e-65locus:ire-1 status:Partially
_confirmed UniProt:E5QCG0
protein_id:CBY24252.1
DictyBaseDDB_G02676506.996751372006089e-64ireA on chromosome: 1 position
495110 to 498317
SGDYHR079C6.996751372006089e-64IRE1 Serine-threonine kinase a
nd endoribonuclease; transmemb
rane protein that mediates the
unfolded protein response (UP
R) by regulating Hac1p synthes
is through HAC1 mRNA splicing;
Kar2p binds inactive Ire1p an
d releases from it upon ER str
ess
OxytrichaContig237.1.g1293.999925618735366e-62Protein kinase domain
Stentor CoeruleusSteCoe_94781.462486227251231e-31

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:SUPR000393

Sequences

>TTHERM_00641080(coding)
ATGATAATCTATTTCAATAGTTTTTTTAAGAAATTTGTTTAAAATTAAAAGTAAATAAGA
TTTATACTGCCTTATTTCATCATTAAGTTTATATAAATTATTAATACAAAATAAAACATG
AATAACTTTTAAAATTTCTTCAAAAAGTAAAAAAAACTTATTGCCATTTTTATATTACTT
TTATTAATAAATGGCACTTTAGCTTAGCATAGCAATAAAAAAAGCTAGACTCAGAATAAT
AGTTCTGAGACGGCTTTAACTCATTCTAAAGTAGACAAAGATGCCTATCTAGTATTAACT
AATGATGGCAAATTATATAGCTATAATATAAAGAAAAAGTTGTTAAATTGGATGACAGAT
CTGAAAGTAGTTGTTAGCGAGCTCAAATTCAATAACGAAAAACAATAGTAGGATAATTAT
GGAATGGAAGATCAGCACTCTACTGAACTCTCTATTGCAGGAAATTAGGAATCTAACTTT
GAGAGATACGACTATTTTTTGCCCTCTTCTGATGGAAATTTTATCTTTTTAGCATCAGAT
TCTACTCCAATAAAAATTATGCGAGATGAAATAGACCAAGTTATTAAAATATGTCCAATG
AGTGGAAACGAGTCAAAATATATTGCATTTACCAAAGAAAAGATTCTTTTAGTCAATCCT
GAAAATGGGGAATTAGAGAAATTTGAAGATATTGAAGATGATTATGAAAACTATTTAAAT
CATTATATTATCAATATCAACTAGAAACTTATTAAGCAACTTAATATTTTTACCAAAAGA
GAAAATTGGGCTTTAACCAGCACAGATGTTAATTTGATGATTTATGAAGACTTTTTATAC
AAAGGATTATAAAAAAATCAGCTTACTGAAAATGAGGATTATATTTTTATGTAAGATTAG
CATTAAGATTTGAAAATTAAGCAAAAGCAATCAAAGATTAAAATAGTTGATTTCTAAACA
GATTAGGAAATTATTGCTATTTTTTCTGCAGTTGGATTTACAAACATGTTTTAAAAGAAT
GTCATAGTGCATAATCCTCTTATCAATACGTTCATATCTTCAGAATATGATAACACATAG
ATTTAAATAGGTGGAGAGAAAGGCATAGTTTCGTTTAATGAAGGGAGCAACTTTTAGCTA
ATACCATTGTAGATTTCTACAAAGCTAAAGAATTAGTGTTTAGAAAATAAGTAATGCAGA
GAAAGATTGATTTTTAGTGTTGATAAATTTGATGATAAAAATTATATCAGAGATGTTATG
ACTTGCATAGATAACCTCAGAAAGGGGAGAATGATGATTGAAGTTATATCTGATAGTAAG
GATATCTAGAATGCCAGCAATATTCCTAGTTAAGCATTCAATTTTGCTAAGGATAATAAA
ATTACAATATTCTTGCTGACATTCTTAATTATCTTGGTTATTATTCTGATTTTAAAAGAT
GAAAGAATTACTTCTATGTATAAAAGAAATAGTGGTCGTTCTGGAGGTAAATCTTCCAGT
TAAAAATAAAACTCCCAAGAAGAAGCTGATAAAGTCTTAGAAAAAATTAGCAAAGAGCAA
GAAGAAGAAATTAAAAAACAAAATGAGCAAAATAATAAATAAGAAAAAAAGAACCAAGAG
AGTAGCGAATAAAATGCAAATAAATTTAAAGGGCTTTAAATTAATAGAAATAAAGTTTTA
GGGTATGGGGCTTAAGGGACAGTTATTTTTGAAGGAACATTTTAAGGAAGAGAAATTGCA
GTCAAATAGTTACTTAAAGATAATAAAGACTTAGCTAGCAAGGAAATATAAATGTTGATT
AAGCTGCAACACAAAAATATAATTAAGTACTACTATTTTGAGGAAACAAAAGATCACATA
CTTCTTGGACTAGAAAAGTGTGTTGGAAGCATTAGCGATTTAATAGATTATGCAAATAGA
AAAAACAAGAAGAAAAGTGAGTAGGATTTGAAAGCTTTATATAATATAAAAACGGATTTT
TTCATTAAGTCAACTATGAAAAATACATTTAAAGACTGCTTAGAAGGATTGAGTTATTTG
CATAGCTAAGGTGTTATTCATAGAGATATAAAGCCAGAAAATATTTTAATTCACTACAAC
AAAGAAATTAAATTAGCTGATTTTGGACTTTCAAAGAATATTTCTAAAACGAATGTCATA
TTCACGAATGATATCGGCACATGGGGATGGAGACCACTAGAATAAATAGATAATTAACCA
CTTACATATAATACAGATGTTTTCTCTCTTGGCTGTGTATTCTATTACATATACACTTAA
GGAGGTCATCCTTTTGGAGAATAGAAAGAAAGGGAAAGAAACATAGCTAATTTTAAGTAC
AGCTTGAGAATGGAAGATGAAACCTTGAAAGACCTTATCCAAAAAATGATTCATAATGAT
CAAAGTAAAAGACTGACTGTAAAAGAATGCTTAAAGCATCCATATTTCTGGAATACCTTG
TAAAAGTTCTCTTTTATTTGCGAATTTAGTGACTACATAGAAACATTTGATACTGAAAAT
AAATATTCAGACTTGATTGAATAATAAGCAAAGTCTTTGAATGTTTTAGAAGGAAATAGA
TGGGATAAAAATGTAGATAAAAGTCTTATTTAAGATACTAAAGTGTTTAAATTCTACAAC
TATGGATAGGTTAAAGATCTTATCAGATTAATAAGGAACAGAAAAAGTCATTATCACGAG
CTTTCAGAGAGCTCTAAAGATATAGTAGGAGATACTCTTGATGATATGTTTAACTATTTT
GATGAAAGATTCCCTAAATTATTTATTTTTATGTATTATTTCTCACAAACTTAAAACTGG
GAATTACTAAGCTTTAAAAATAACTGA


>TTHERM_00641080(protein)
MIIYFNSFFKKFVQNQKQIRFILPYFIIKFIQIINTKQNMNNFQNFFKKQKKLIAIFILL
LLINGTLAQHSNKKSQTQNNSSETALTHSKVDKDAYLVLTNDGKLYSYNIKKKLLNWMTD
LKVVVSELKFNNEKQQQDNYGMEDQHSTELSIAGNQESNFERYDYFLPSSDGNFIFLASD
STPIKIMRDEIDQVIKICPMSGNESKYIAFTKEKILLVNPENGELEKFEDIEDDYENYLN
HYIININQKLIKQLNIFTKRENWALTSTDVNLMIYEDFLYKGLQKNQLTENEDYIFMQDQ
HQDLKIKQKQSKIKIVDFQTDQEIIAIFSAVGFTNMFQKNVIVHNPLINTFISSEYDNTQ
IQIGGEKGIVSFNEGSNFQLIPLQISTKLKNQCLENKQCRERLIFSVDKFDDKNYIRDVM
TCIDNLRKGRMMIEVISDSKDIQNASNIPSQAFNFAKDNKITIFLLTFLIILVIILILKD
ERITSMYKRNSGRSGGKSSSQKQNSQEEADKVLEKISKEQEEEIKKQNEQNNKQEKKNQE
SSEQNANKFKGLQINRNKVLGYGAQGTVIFEGTFQGREIAVKQLLKDNKDLASKEIQMLI
KLQHKNIIKYYYFEETKDHILLGLEKCVGSISDLIDYANRKNKKKSEQDLKALYNIKTDF
FIKSTMKNTFKDCLEGLSYLHSQGVIHRDIKPENILIHYNKEIKLADFGLSKNISKTNVI
FTNDIGTWGWRPLEQIDNQPLTYNTDVFSLGCVFYYIYTQGGHPFGEQKERERNIANFKY
SLRMEDETLKDLIQKMIHNDQSKRLTVKECLKHPYFWNTLQKFSFICEFSDYIETFDTEN
KYSDLIEQQAKSLNVLEGNRWDKNVDKSLIQDTKVFKFYNYGQVKDLIRLIRNRKSHYHE
LSESSKDIVGDTLDDMFNYFDERFPKLFIFMYYFSQTQNWELLSFKNN


>TTHERM_00641080(gene)
ATGATAATCTATTTCAATAGTTTTTTTAAGAAATTTGTTTAAAATTAAAAGTAAATAAGA
TTTATACTGCCTTATTTCATCATTAAGTTTATATAAATTATTAATACAAAATAAAACATG
AATAACTTTTAAAATTTCTTCAAAAAGTAAAAAAAACTTATTGCCATTTTTATATTACTT
TTATTAATAAATGGCACTTTAGCTTAGCATAGCAATAAAAAAAGCTAGACTCAGAATAAT
AGTTCTGAGACGGCTTTAACTCATTCTAAAGTAGACAAAGATGCCTATCTAGTATATCAT
TTATTTCATTCATCATTATTGTTGTTGTTTTAACTTTATAAGCCATAACAAATTTAAATT
TTATTTGATAGGTATTAACTAATGATGGCAAATTATATAGCTATAATATAAAGAAAAAGT
TGTTAAATTGGATGACAGATCTGAAAGTAGTTGTTAGCGAGCTCAAATTCAATAACGAAA
AACAATAGTAGGATAATTATGGAATGGAAGATCAGCACTCTACTGAACTCTCTATTGCAG
GAAATTAGGAATCTAACTTTGAGAGATACGACTATTTTTTGCCCTCTTCTGATGGAAATT
TTATCTTTTTAGCATCAGATTCTACTCCAATAGTACATACACAATAAACAAATAATTGAT
TAAATTTAAAATAAATATCATTATTTTTAGAAAATTATGCGAGATGAAATAGACCAAGTT
ATTAAAATATGTCCAATGAGTGGAAACGAGTCAAAATATATTGCATTTACCAAAGAAAAG
ATTCTTTTAGTCAATCCTGAAAATGGGGAATTAGAGAAATTTGAAGATATTGAAGATGAT
TATGAAAACTATTTAAATCATTATATTATCAATATCAACTAGAAACTTATTAAGCAACTT
AATATTTTTACCAAAAGAGAAAATTGGGCTTTAACCAGCACAGATGTTAATTTGATGATT
TATGAAGACTTTTTATACAAAGGATTATAAAAAAATCAGCTTACTGAAAATGAGGATTAT
ATTTTTATGTAAGATTAGCATTAAGATTTGAAAATTAAGCAAAAGCAATCAAAGATTAAA
ATAGTTGATTTCTAAACAGATTAGGAAATTATTGCTATTTTTTCTGCAGTTGGATTTACA
AACATGTTTTAAAAGAATGTCATAGTGCATAATCCTCTTATCAATACGTTCATATCTTCA
GAATATGTAAGATTTATTTATTGATTTTTTGTTGTTAAATTAAAATTTATTTTTTTTTAT
CAAGGATAACACATAGATTTAAATAGGTGGAGAGAAAGGCATAGTTTCGTTTAATGAAGG
GAGCAACTTTTAGCTAATACCATTGTAGATTTCTACAAAGCTAAAGAATTAGTGTTTAGA
AAATAAGTAATGCAGAGAAAGATTGATTTTTAGTGTTGATAAATTTGATGATAAAAATTA
TATCAGAGATGTTATGACTTGCATAGATAACCTCAGAAAGGGGAGAATGATGATTGAAGT
TATATCTGATAGTAAGGATATCTAGAATGCCAGCAATATTCCTAGTTAAGCATTCAATTT
TGCTAAGGATAATAAAATTACAATATTCTTGCTGACATTCTTAATTATCTTGGTTATTAT
TCTGATTTTAAAAGATGAAAGAATTACTTCTATGTATAAAAGAAATAGTGGTCGTTCTGG
AGGTAAATCTTCCAGTTAAAAATAAAACTCCCAAGAAGAAGCTGATAAAGTCTTAGAAAA
AATTAGCAAAGAGCAAGAAGAAGAAATTAAAAAACAAAATGAGCAAAATAATAAATAAGA
AAAAAAGAACCAAGAGAGTAGCGAATAAAATGCAAATAAATTTAAAGGGCTTTAAATTAA
TAGAAATAAAGTTTTAGGGTATGGGGCTTAAGGGACAGTTATTTTTGAAGGAACATTTTA
AGGTAATATTTAAGAATAAAAAATAGTTTTTGATTTAATAAATATTGTTTATGTGAATAT
AGGAAGAGAAATTGCAGTCAAATAGTTACTTAAAGATAATAAAGACTTAGCTAGCAAGGA
AATATAAATGTTGATTAAGCTGCAACACAAAAATATAATTAAGTACTACTATTTTGAGGA
AACAAAAGATCACATACTTCTTGGACTAGAAAAGTGTGTTGGAAGCATTAGCGATTTAAT
AGATTATGCAAATAGAAAAAACAAGAAGAAAAGTGAGTAGGATTTGAAAGCTTTATATAA
TATAAAAACGGATTTTTTCATTAAGTCAACTATGAAAAATACATTTAAAGACTGCTTAGA
AGGATTGAGTTATTTGCATAGCTAAGGTGTTATTCATAGAGATATAAAGCCAGAAAATAT
TTTAATTCACTACAACAAAGAAATTAAATTAGCTGATTTTGGACTTTCAAAGAATATTTC
TAAAACGAATGTCATATTCACGAATGATATCGGCACATGGGGATGGAGACCACTAGAATA
AATAGATAATTAACCACTTACATATAATACAGATGTTTTCTCTCTTGGCTGTGTATTCTA
TTACATATACACTTAAGGAGGTCATCCTTTTGGAGAATAGTAATTTCATAACATTAAAAA
AATAGAAAATTAAGAAATAATGTTTAAAAAAATAAATAGGAAAGAAAGGGAAAGAAACAT
AGCTAATTTTAAGTACAGCTTGAGAATGGAAGATGAAACCTTGAAAGACCTTATCCAAAA
AATGATTCATAATGATCAAAGTAAAAGACTGACTGTAAAAGAATGCTTAAAGCATCCATA
TTTCTGGAATACCTTGTAAAAGTTCTCTTTTATTTGCGAATTTAGTGACTACATAGAAAC
ATTTGGTAACTTTAAATCAAAATATTTACTTTTATATTTTAGTGAATATTGATAATTGTA
ATAAATTTAGATACTGAAAATAAATATTCAGACTTGATTGAATAATAAGCAAAGTCTTTG
AATGTTTTAGAAGGAAATAGATGGGATAAAAATGTAGATAAAAGTCTTATTTAAGATACT
AAAGTGTTTAAATTCTACAACTATGGATAGGTTAAAGATCTTATCAGAGTAAATTTTTCA
AATAAGATTTTTTTTAATAATGAATTTTTTAAATAGTTAATAAGGAACAGAAAAAGTCAT
TATCACGAGCTTTCAGAGAGCTCTAAAGATATAGTAGGAGATACTCTTGATGATATGTTT
AACTATTTTGATGAAAGATTCCCTAAATTATTTATTTTTATGTATTATTTCTCACAAACT
TAAAACTGGGAATTACTAAGCTTTAAAAATAACTGA