Identifiers and Description

Gene Model Identifier

TTHERM_00641080

Standard Name

IRE1 (Inositol REquiring)

Aliases

PreTt10577 | 92.m00119

Description

Homolog of yeast IRE1; Protein kinase domain containing protein. Sequence similarity to the IRE protein kinase family (Eisen et al., 2006)."

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( PF04383 ) KilA-N domain
  • ( PF06479 ) Ribonuclease 2-5A
  • ( PF00069 ) protein kinase domain
  • ( PF07714 ) protein tyrosine kinase
  • ( PF05316 ) Mitochondrial ribosomal protein (VAR1)

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 18.3%

TetraMine Data

TTHERM_00641080

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_05206.19.997093137033517e-262protein kinase domain-containi
ng protein (920 aa)
WormBaseWBGene000021471.9997677415930956e-65locus:ire-1 status:Partially
_confirmed UniProt:E5QCG0
protein_id:CBY24252.1
DictyBaseDDB_G02676506.996751372006089e-64ireA on chromosome: 1 position
495110 to 498317
SGDYHR079C6.996751372006089e-64IRE1 Serine-threonine kinase a
nd endoribonuclease; transmemb
rane protein that mediates the
unfolded protein response (UP
R) by regulating Hac1p synthes
is through HAC1 mRNA splicing;
Kar2p binds inactive Ire1p an
d releases from it upon ER str
ess
OxytrichaContig237.1.g1293.999925618735366e-62Protein kinase domain
Stentor CoeruleusSteCoe_94781.462486227251231e-31

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:SUPR000393

Sequences

>TTHERM_00641080(coding)
ATGATAATCTATTTCAATAGTTTTTTTAAGAAATTTGTTTAAAATTAAAAGTAAATAAGA
TTTATACTGCCTTATTTCATCATTAAGTTTATATAAATTATTAATACAAAATAAAACATG
AATAACTTTTAAAATTTCTTCAAAAAGTAAAAAAAACTTATTGCCATTTTTATATTACTT
TTATTAATAAATGGCACTTTAGCTTAGCATAGCAATAAAAAAAGCTAGACTCAGAATAAT
AGTTCTGAGACGGCTTTAACTCATTCTAAAGTAGACAAAGATGCCTATCTAGTATTAACT
AATGATGGCAAATTATATAGCTATAATATAAAGAAAAAGTTGTTAAATTGGATGACAGAT
CTGAAAGTAGTTGTTAGCGAGCTCAAATTCAATAACGAAAAACAATAGTAGGATAATTAT
GGAATGGAAGATCAGCACTCTACTGAACTCTCTATTGCAGGAAATTAGGAATCTAACTTT
GAGAGATACGACTATTTTTTGCCCTCTTCTGATGGAAATTTTATCTTTTTAGCATCAGAT
TCTACTCCAATAAAAATTATGCGAGATGAAATAGACCAAGTTATTAAAATATGTCCAATG
AGTGGAAACGAGTCAAAATATATTGCATTTACCAAAGAAAAGATTCTTTTAGTCAATCCT
GAAAATGGGGAATTAGAGAAATTTGAAGATATTGAAGATGATTATGAAAACTATTTAAAT
CATTATATTATCAATATCAACTAGAAACTTATTAAGCAACTTAATATTTTTACCAAAAGA
GAAAATTGGGCTTTAACCAGCACAGATGTTAATTTGATGATTTATGAAGACTTTTTATAC
AAAGGATTATAAAAAAATCAGCTTACTGAAAATGAGGATTATATTTTTATGTAAGATTAG
CATTAAGATTTGAAAATTAAGCAAAAGCAATCAAAGATTAAAATAGTTGATTTCTAAACA
GATTAGGAAATTATTGCTATTTTTTCTGCAGTTGGATTTACAAACATGTTTTAAAAGAAT
GTCATAGTGCATAATCCTCTTATCAATACGTTCATATCTTCAGAATATGATAACACATAG
ATTTAAATAGGTGGAGAGAAAGGCATAGTTTCGTTTAATGAAGGGAGCAACTTTTAGCTA
ATACCATTGTAGATTTCTACAAAGCTAAAGAATTAGTGTTTAGAAAATAAGTAATGCAGA
GAAAGATTGATTTTTAGTGTTGATAAATTTGATGATAAAAATTATATCAGAGATGTTATG
ACTTGCATAGATAACCTCAGAAAGGGGAGAATGATGATTGAAGTTATATCTGATAGTAAG
GATATCTAGAATGCCAGCAATATTCCTAGTTAAGCATTCAATTTTGCTAAGGATAATAAA
ATTACAATATTCTTGCTGACATTCTTAATTATCTTGGTTATTATTCTGATTTTAAAAGAT
GAAAGAATTACTTCTATGTATAAAAGAAATAGTGGTCGTTCTGGAGGTAAATCTTCCAGT
TAAAAATAAAACTCCCAAGAAGAAGCTGATAAAGTCTTAGAAAAAATTAGCAAAGAGCAA
GAAGAAGAAATTAAAAAACAAAATGAGCAAAATAATAAATAAGAAAAAAAGAACCAAGAG
AGTAGCGAATAAAATGCAAATAAATTTAAAGGGCTTTAAATTAATAGAAATAAAGTTTTA
GGGTATGGGGCTTAAGGGACAGTTATTTTTGAAGGAACATTTTAAGGAAGAGAAATTGCA
GTCAAATAGTTACTTAAAGATAATAAAGACTTAGCTAGCAAGGAAATATAAATGTTGATT
AAGCTGCAACACAAAAATATAATTAAGTACTACTATTTTGAGGAAACAAAAGATCACATA
CTTCTTGGACTAGAAAAGTGTGTTGGAAGCATTAGCGATTTAATAGATTATGCAAATAGA
AAAAACAAGAAGAAAAGTGAGTAGGATTTGAAAGCTTTATATAATATAAAAACGGATTTT
TTCATTAAGTCAACTATGAAAAATACATTTAAAGACTGCTTAGAAGGATTGAGTTATTTG
CATAGCTAAGGTGTTATTCATAGAGATATAAAGCCAGAAAATATTTTAATTCACTACAAC
AAAGAAATTAAATTAGCTGATTTTGGACTTTCAAAGAATATTTCTAAAACGAATGTCATA
TTCACGAATGATATCGGCACATGGGGATGGAGACCACTAGAATAAATAGATAATTAACCA
CTTACATATAATACAGATGTTTTCTCTCTTGGCTGTGTATTCTATTACATATACACTTAA
GGAGGTCATCCTTTTGGAGAATAGAAAGAAAGGGAAAGAAACATAGCTAATTTTAAGTAC
AGCTTGAGAATGGAAGATGAAACCTTGAAAGACCTTATCCAAAAAATGATTCATAATGAT
CAAAGTAAAAGACTGACTGTAAAAGAATGCTTAAAGCATCCATATTTCTGGAATACCTTG
TAAAAGTTCTCTTTTATTTGCGAATTTAGTGACTACATAGAAACATTTGATACTGAAAAT
AAATATTCAGACTTGATTGAATAATAAGCAAAGTCTTTGAATGTTTTAGAAGGAAATAGA
TGGGATAAAAATGTAGATAAAAGTCTTATTTAAGATACTAAAGTGTTTAAATTCTACAAC
TATGGATAGGTTAAAGATCTTATCAGATTAATAAGGAACAGAAAAAGTCATTATCACGAG
CTTTCAGAGAGCTCTAAAGATATAGTAGGAGATACTCTTGATGATATGTTTAACTATTTT
GATGAAAGATTCCCTAAATTATTTATTTTTATGTATTATTTCTCACAAACTTAAAACTGG
GAATTACTAAGCTTTAAAAATAACTGA


>TTHERM_00641080(protein)
MIIYFNSFFKKFVQNQKQIRFILPYFIIKFIQIINTKQNMNNFQNFFKKQKKLIAIFILL
LLINGTLAQHSNKKSQTQNNSSETALTHSKVDKDAYLVLTNDGKLYSYNIKKKLLNWMTD
LKVVVSELKFNNEKQQQDNYGMEDQHSTELSIAGNQESNFERYDYFLPSSDGNFIFLASD
STPIKIMRDEIDQVIKICPMSGNESKYIAFTKEKILLVNPENGELEKFEDIEDDYENYLN
HYIININQKLIKQLNIFTKRENWALTSTDVNLMIYEDFLYKGLQKNQLTENEDYIFMQDQ
HQDLKIKQKQSKIKIVDFQTDQEIIAIFSAVGFTNMFQKNVIVHNPLINTFISSEYDNTQ
IQIGGEKGIVSFNEGSNFQLIPLQISTKLKNQCLENKQCRERLIFSVDKFDDKNYIRDVM
TCIDNLRKGRMMIEVISDSKDIQNASNIPSQAFNFAKDNKITIFLLTFLIILVIILILKD
ERITSMYKRNSGRSGGKSSSQKQNSQEEADKVLEKISKEQEEEIKKQNEQNNKQEKKNQE
SSEQNANKFKGLQINRNKVLGYGAQGTVIFEGTFQGREIAVKQLLKDNKDLASKEIQMLI
KLQHKNIIKYYYFEETKDHILLGLEKCVGSISDLIDYANRKNKKKSEQDLKALYNIKTDF
FIKSTMKNTFKDCLEGLSYLHSQGVIHRDIKPENILIHYNKEIKLADFGLSKNISKTNVI
FTNDIGTWGWRPLEQIDNQPLTYNTDVFSLGCVFYYIYTQGGHPFGEQKERERNIANFKY
SLRMEDETLKDLIQKMIHNDQSKRLTVKECLKHPYFWNTLQKFSFICEFSDYIETFDTEN
KYSDLIEQQAKSLNVLEGNRWDKNVDKSLIQDTKVFKFYNYGQVKDLIRLIRNRKSHYHE
LSESSKDIVGDTLDDMFNYFDERFPKLFIFMYYFSQTQNWELLSFKNN


>TTHERM_00641080(gene)
ATGATAATCTATTTCAATAGTTTTTTTAAGAAATTTGTTTAAAATTAAAAGTAAATAAGA
TTTATACTGCCTTATTTCATCATTAAGTTTATATAAATTATTAATACAAAATAAAACATG
AATAACTTTTAAAATTTCTTCAAAAAGTAAAAAAAACTTATTGCCATTTTTATATTACTT
TTATTAATAAATGGCACTTTAGCTTAGCATAGCAATAAAAAAAGCTAGACTCAGAATAAT
AGTTCTGAGACGGCTTTAACTCATTCTAAAGTAGACAAAGATGCCTATCTAGTATATCAT
TTATTTCATTCATCATTATTGTTGTTGTTTTAACTTTATAAGCCATAACAAATTTAAATT
TTATTTGATAGGTATTAACTAATGATGGCAAATTATATAGCTATAATATAAAGAAAAAGT
TGTTAAATTGGATGACAGATCTGAAAGTAGTTGTTAGCGAGCTCAAATTCAATAACGAAA
AACAATAGTAGGATAATTATGGAATGGAAGATCAGCACTCTACTGAACTCTCTATTGCAG
GAAATTAGGAATCTAACTTTGAGAGATACGACTATTTTTTGCCCTCTTCTGATGGAAATT
TTATCTTTTTAGCATCAGATTCTACTCCAATAGTACATACACAATAAACAAATAATTGAT
TAAATTTAAAATAAATATCATTATTTTTAGAAAATTATGCGAGATGAAATAGACCAAGTT
ATTAAAATATGTCCAATGAGTGGAAACGAGTCAAAATATATTGCATTTACCAAAGAAAAG
ATTCTTTTAGTCAATCCTGAAAATGGGGAATTAGAGAAATTTGAAGATATTGAAGATGAT
TATGAAAACTATTTAAATCATTATATTATCAATATCAACTAGAAACTTATTAAGCAACTT
AATATTTTTACCAAAAGAGAAAATTGGGCTTTAACCAGCACAGATGTTAATTTGATGATT
TATGAAGACTTTTTATACAAAGGATTATAAAAAAATCAGCTTACTGAAAATGAGGATTAT
ATTTTTATGTAAGATTAGCATTAAGATTTGAAAATTAAGCAAAAGCAATCAAAGATTAAA
ATAGTTGATTTCTAAACAGATTAGGAAATTATTGCTATTTTTTCTGCAGTTGGATTTACA
AACATGTTTTAAAAGAATGTCATAGTGCATAATCCTCTTATCAATACGTTCATATCTTCA
GAATATGTAAGATTTATTTATTGATTTTTTGTTGTTAAATTAAAATTTATTTTTTTTTAT
CAAGGATAACACATAGATTTAAATAGGTGGAGAGAAAGGCATAGTTTCGTTTAATGAAGG
GAGCAACTTTTAGCTAATACCATTGTAGATTTCTACAAAGCTAAAGAATTAGTGTTTAGA
AAATAAGTAATGCAGAGAAAGATTGATTTTTAGTGTTGATAAATTTGATGATAAAAATTA
TATCAGAGATGTTATGACTTGCATAGATAACCTCAGAAAGGGGAGAATGATGATTGAAGT
TATATCTGATAGTAAGGATATCTAGAATGCCAGCAATATTCCTAGTTAAGCATTCAATTT
TGCTAAGGATAATAAAATTACAATATTCTTGCTGACATTCTTAATTATCTTGGTTATTAT
TCTGATTTTAAAAGATGAAAGAATTACTTCTATGTATAAAAGAAATAGTGGTCGTTCTGG
AGGTAAATCTTCCAGTTAAAAATAAAACTCCCAAGAAGAAGCTGATAAAGTCTTAGAAAA
AATTAGCAAAGAGCAAGAAGAAGAAATTAAAAAACAAAATGAGCAAAATAATAAATAAGA
AAAAAAGAACCAAGAGAGTAGCGAATAAAATGCAAATAAATTTAAAGGGCTTTAAATTAA
TAGAAATAAAGTTTTAGGGTATGGGGCTTAAGGGACAGTTATTTTTGAAGGAACATTTTA
AGGTAATATTTAAGAATAAAAAATAGTTTTTGATTTAATAAATATTGTTTATGTGAATAT
AGGAAGAGAAATTGCAGTCAAATAGTTACTTAAAGATAATAAAGACTTAGCTAGCAAGGA
AATATAAATGTTGATTAAGCTGCAACACAAAAATATAATTAAGTACTACTATTTTGAGGA
AACAAAAGATCACATACTTCTTGGACTAGAAAAGTGTGTTGGAAGCATTAGCGATTTAAT
AGATTATGCAAATAGAAAAAACAAGAAGAAAAGTGAGTAGGATTTGAAAGCTTTATATAA
TATAAAAACGGATTTTTTCATTAAGTCAACTATGAAAAATACATTTAAAGACTGCTTAGA
AGGATTGAGTTATTTGCATAGCTAAGGTGTTATTCATAGAGATATAAAGCCAGAAAATAT
TTTAATTCACTACAACAAAGAAATTAAATTAGCTGATTTTGGACTTTCAAAGAATATTTC
TAAAACGAATGTCATATTCACGAATGATATCGGCACATGGGGATGGAGACCACTAGAATA
AATAGATAATTAACCACTTACATATAATACAGATGTTTTCTCTCTTGGCTGTGTATTCTA
TTACATATACACTTAAGGAGGTCATCCTTTTGGAGAATAGTAATTTCATAACATTAAAAA
AATAGAAAATTAAGAAATAATGTTTAAAAAAATAAATAGGAAAGAAAGGGAAAGAAACAT
AGCTAATTTTAAGTACAGCTTGAGAATGGAAGATGAAACCTTGAAAGACCTTATCCAAAA
AATGATTCATAATGATCAAAGTAAAAGACTGACTGTAAAAGAATGCTTAAAGCATCCATA
TTTCTGGAATACCTTGTAAAAGTTCTCTTTTATTTGCGAATTTAGTGACTACATAGAAAC
ATTTGGTAACTTTAAATCAAAATATTTACTTTTATATTTTAGTGAATATTGATAATTGTA
ATAAATTTAGATACTGAAAATAAATATTCAGACTTGATTGAATAATAAGCAAAGTCTTTG
AATGTTTTAGAAGGAAATAGATGGGATAAAAATGTAGATAAAAGTCTTATTTAAGATACT
AAAGTGTTTAAATTCTACAACTATGGATAGGTTAAAGATCTTATCAGAGTAAATTTTTCA
AATAAGATTTTTTTTAATAATGAATTTTTTAAATAGTTAATAAGGAACAGAAAAAGTCAT
TATCACGAGCTTTCAGAGAGCTCTAAAGATATAGTAGGAGATACTCTTGATGATATGTTT
AACTATTTTGATGAAAGATTCCCTAAATTATTTATTTTTATGTATTATTTCTCACAAACT
TAAAACTGGGAATTACTAAGCTTTAAAAATAACTGA