Identifiers and Description

Gene Model Identifier

TTHERM_00255600

Standard Name

IPT1 (tRNA isopentenyltransferase 1)

Aliases

PreTt25345 | 22.m00290

Description

tRNA isopentenyltransferase

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( PF06220 ) U1 zinc finger
  • ( PF01715 ) IPP transferase
  • ( PF00096 ) Zinc finger, C2H2 type
  • ( PF02888 ) Calmodulin binding domain
  • ( TIGR00174 ) tRNA delta(2)-isopentenylpyrophosphate transferase

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00255600

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_10429.19.997093137033517e-262tRNA delta(2)-isopentenylpyrop
hosphate transferase (574 aa)
OxytrichaContig19427.0.g81.0000422327488734e-24IPP transferase
DictyBaseDDB_G02915281.9994498063102785e-22iptB on chromosome: 6 position
482754 to 484435
SGDYOR274W1.0002869940498747e-21MOD5 Delta 2-isopentenyl pyrop
hosphate:tRNA isopentenyl tran
sferase, required for biosynth
esis of the modified base isop
entenyladenosine in mitochondr
ial and cytoplasmic tRNAs; gen
e is nuclear and encodes two i
sozymic forms
WormBaseWBGene000017409.995317835403734e-19locus:gro-1 status:Confirmed
UniProt:G5EBS1 protein_id
:CCD66664.1
Stentor CoeruleusSteCoe_192280.00000000000003442477108469977

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00255600(coding)
ATGCTATTTAGGAGAAATATGGAAAAAAAAATACAGAACTTTTCTTTATACATAATAGGA
ACAACAGCTACTGGCAAAACTAAATTATCACTCAATATTGGGGAAAGATTTAAAGGCTAA
GTAGTATCTGCAGACTCTATGCAAATGTATAGACATGCTGATATTCTAACTGCGAAGGCT
ACAAAAGAAGAACAATCTATTGTTAAGCACCATATGATTGATATTTTTGATCTATAAGTA
GTCAATTTTAACAGAAACGACTACTATTATTTGGCTAAGTAGGCCTTTGATAAGATTCAC
TCAGAAAATTCCTTCCCAATAGTCATTGGTGGAACAAATTATTATATCGAAACCCTTTTA
TTTAAGCAAAAAATAGCTGAAAATAGAATTAATTTAGAAGATCCAAATGCTTTTATCTTG
GAAATGTAAAAGAAAGCCCTCACAAATTTTGGCAATACAGACGAAAATTATCCGCTTTAA
AAGTATTAAAAAAATGACAATGAAAGCAACTAATAATTGAAAAGCAAAGATAATGAATCC
TAAGAAGATGAAGATGAAGAATACGAAAATAATTTACCACCTTTATATGAAAATGATAAC
ATTTAGAAATCAAAAGAAGTCCTTGATAAAGAATAGGAAGTTAGGATATAGCTTTAATAA
ATGTCCAATGAAGAAAAATACAAATAATTAAAGGAGCTGGATCCTCTTATTGCAAATAAA
TTACATCCAAATGATGAAAGAAGAATATAAAGCTATTTGATGTAGGCTTTAGTCACAGGT
ATACCTCCTAGTAATTCAATGGAAGATCACGAAAATGTTCCATTGAGAGATAAAAACTGT
TTGATCTTTTGGCCAAGATGTAAGTCAAAGGAAAAGTTAGATGCTTAAATTAGAAAAAGA
ATTTATGAAATGATTTCTGAAAATGGAATTTACGAAGCCTTTTATATTTTCGAAACAATA
ATACCATAAAATGTAGAATCAGAGGAAGATCCAATTTTCCTTAAAGGTGTGTTACAATCT
ATTGGATATAAAGAATTCTTCCCTTTCTATAGACTCTATTTATCTAGAAACTATCCTCAT
AATTTATCAAAAGAAGAAAAGACTGCATAAATTAAATAATTAATGTATGAAGACGAGGAA
GGGAAAAAGGTTATTACTTAATGCATAGAGAAATTAGTTACACATACCATATAGTATACA
AAGAGGTAACTAAAGTGGATTAGACATAGAATTATGATGAATTCAGATAGCGAAGAAATC
AAAAACAGACTCTTTGTTTTTGAATTTGATGAATTTACTTCTGAAAACTTTAAAGAAAAA
GCAATTAATCCAGCAAATGAAATAATTTCAAAATACTTTGAGTTGGCAGAAAAATATAAT
GAATCAAATGGAGATTAGCATCCAATTGAATAATTAGCAAATGATGAATTCTTAAAATAG
TATCTTATTAAATTGGATGAGCTCATGGACGTAAGAAAAGCGCATATGAAGAAGGGACTG
AAGGATTGGAAAAACTATTACTGTGATATATGCAAAAAGGAAATACATGGAGAACTAAAC
TGGTCTATTCACAACACAAGCAGAAAACATAAAAAGGCTATTAAACATATTGAAAAATCT
GCAATAAGAGCAAAATATTAAGAATTAAAATCTAAAAAGGAAGAATTAAATGAAAAAGAT
GGAAAAGAAGATAAATCCAAGTTAAGTAGTGATGAAGACCTTAATGAAAACAATAATTTA
AATGATTAAACATAAGAAAATGATAAAATTTAAGCTGAAAAAGATAAACACGATTGA


>TTHERM_00255600(protein)
MLFRRNMEKKIQNFSLYIIGTTATGKTKLSLNIGERFKGQVVSADSMQMYRHADILTAKA
TKEEQSIVKHHMIDIFDLQVVNFNRNDYYYLAKQAFDKIHSENSFPIVIGGTNYYIETLL
FKQKIAENRINLEDPNAFILEMQKKALTNFGNTDENYPLQKYQKNDNESNQQLKSKDNES
QEDEDEEYENNLPPLYENDNIQKSKEVLDKEQEVRIQLQQMSNEEKYKQLKELDPLIANK
LHPNDERRIQSYLMQALVTGIPPSNSMEDHENVPLRDKNCLIFWPRCKSKEKLDAQIRKR
IYEMISENGIYEAFYIFETIIPQNVESEEDPIFLKGVLQSIGYKEFFPFYRLYLSRNYPH
NLSKEEKTAQIKQLMYEDEEGKKVITQCIEKLVTHTIQYTKRQLKWIRHRIMMNSDSEEI
KNRLFVFEFDEFTSENFKEKAINPANEIISKYFELAEKYNESNGDQHPIEQLANDEFLKQ
YLIKLDELMDVRKAHMKKGLKDWKNYYCDICKKEIHGELNWSIHNTSRKHKKAIKHIEKS
AIRAKYQELKSKKEELNEKDGKEDKSKLSSDEDLNENNNLNDQTQENDKIQAEKDKHD


>TTHERM_00255600(gene)
ATGCTATTTAGGAGAAATATGGAAAAAAAAATACAGAACTTTTCTTTATACATAATAGGA
ACAACAGCTACTGGCAAAACTAAATTATCACTCAATATTGGGGAAAGATTTAAAGGCTAA
GTAGTATCTGCAGACTCTATGCAAATGTATAGACATGCTGATATTCTAACTGCGAAGGCT
ACAAAAGAAGAACAATCTATTGTTAAGCACCATATGATTGATATTTTTGATCTATAAGTA
GTCAATTTTAACAGAAACGACTACTATTATTTGGCTAAGTAGGCCTTTGATAAGATTCAC
TCAGAAAATTCCTTCCCAATAGTCATTGGTGGAACAAATTATTATATCGAAACCCTTTTA
TTTAAGCAAAAAATAGCTGAAAATAGAATTAATTTAGAAGATCCAAATGCTTTTATCTTG
GAAATGTAAAAGAAAGCCCTCACAAATTTTGGCAATACAGACGAAAATTATCCGCTTTAA
AAGTATTAAAAAAATGACAATGAAAGCAACTAATAATTGAAAAGCAAAGATAATGAATCC
TAAGAAGATGAAGATGAAGAATACGAAAATAATTTACCACCTTTATATGAAAATGATAAC
ATTTAGAAATCAAAAGAAGTCCTTGATAAAGAATAGGAAGTTAGGATATAGCTTTAATAA
ATGTCCAATGAAGAAAAATACAAATAATTAAAGGAGCTGGATCCTCTTATTGCAAATAAA
TTACATCCAAATGATGAAAGAAGAATATAAAGCTATTTGATGTAGGCTTTAGTCACAGGT
ATACCTCCTAGTAATTCAATGGAAGATCACGAAAATGTTCCATTGAGAGATAAAAACTGT
TTGATCTTTTGGCCAAGATGTAAGTCAAAGGAAAAGTTAGATGCTTAAATTAGAAAAAGA
ATTTATGAAATGATTTCTGAAAATGGAATTTACGAAGCCTTTTATATTTTCGAAACAATA
ATACCATAAAATGTAGAATCAGAGGAAGATCCAATTTTCCTTAAAGGTGTGTTACAATCT
ATTGGATATAAAGAATTCTTCCCTTTCTATAGACTCTATTTATCTAGAAACTATCCTCAT
AATTTATCAAGTAATTATATTAACTATTCTTTTTGAGTATTTTATCAGCTAGTAGTCACT
TTAACACTAAAATATTATTACTTAGCTTAGTAGTCACTATAAGCAATACTATAATATTAA
TTATATTTTAATTCATACTGAATATCGTTTTAATGTCTTTTAGAATGTTTATTCCTATGA
TTTAAACTAATGGATTAGATTTTATACTAAATATAAAATTAATTTTACAAGATAATATTT
TTTAAGATTTGAATTTACTCATTCAATACATTTTTTTATTTTTTAGAAGAAGAAAAGACT
GCATAAATTAAATAATTAATGTATGAAGACGAGGAAGGGAAAAAGGTTATTACTTAATGC
ATAGAGAAATTAGTTACACATACCATATAGTATACAAAGAGGTAACTAAAGTGGATTAGA
CATAGAATTATGATGAATTCAGATAGCGAAGAAATCAAAAACAGACTCTTTGTTTTTGAA
TTTGATGAATTTACTTCTGAAAACTTTAAAGAAAAAGCAATTAATCCAGCAAATGAAATA
ATTTCAAAATACTTTGAGTTGGCAGAAAAATATAATGAATCAAATGGAGATTAGCATCCA
ATTGAATAATTAGCAAATGATGAATTCTTAAAATAGTATCTTATTAAATTGGATGAGCTC
ATGGACGTAAGAAAAGCGCATATGAAGAAGGGACTGAAGGATTGGAAAAACTATTACTGT
GATATATGCAAAAAGGAAATACATGGAGAACTAAACTGGTCTATTCACAACACAAGCAGA
AAACATAAAAAGGCTATTAAACATATTGAAAAATCTGCAATAAGAGCAAAATATTAAGAA
TTAAAATCTAAAAAGGAAGAATTAAATGAAAAAGATGGAAAAGAAGATAAATCCAAGTTA
AGTAGTGATGAAGACCTTAATGAAAACAATAATTTAAATGATTAAACATAAGAAAATGAT
AAAATTTAAGCTGAAAAAGATAAACACGATTGA