Identifiers and Description

Gene Model Identifier

TTHERM_00962190

Standard Name

IME4 (Homolog of budding yeast IME4 (Inducer of MEiosis))

Aliases

PreTt23707 | 178.m00088 | TRAM-4

Description

In yeast, required for entry into meiosis MT-A70 family protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

  • nucleobase-containing compound metabolic process (IEA) | GO:0006139

Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.4%

TetraMine Data

TTHERM_00962190

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_15839.19.997093137033517e-262MT-A70 family protein (754 aa)
SGDYGL192W1.0002434920975502e-91IME4 Probable mRNA N6-adenosin
e methyltransferase required f
or entry into meiosis; transcr
ibed in diploid cells; haploid
s repress IME4 transcription v
ia production of antisense IME
4 transcripts; antisense trans
cription is repressed in diplo
ids
OxytrichaContig17486.0.g1009.00381557957642e-37MT-A70
Stentor CoeruleusSteCoe_218052.3195228302435696e-16

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:SUPR000353

Sequences

>TTHERM_00962190(coding)
ATGGGAAGCTCTGTAAAAGATTAGGAAATATCAAATAAAAAGCACAAGGCTCGTAATTCT
AGCAGTGGAGCCAATAACAATAGCAATAGCAGTAATTATTAAAGCAGTAAAAGAGACATT
CATTAAGACCGCAGTTATTCGAAGGATGACAGTCAAAGCAGGTAATACAATAGTAACAAC
GGCGGCGGAGGATCAAGCTCTAAAAATAGCAATCGTAACTCATCACAATAGGGTTATAAT
TAGAATTCTTCATCAAATCAAGGATAGAATTCCGAATATGGAGGATCTGGTTCAGGGAAA
AATTCTTAAGCAAATTCATAGAGAAATTCCTCTTAATAAGGATTGTAGTAGTTAAATTAG
CAGTAGTAATCTTAGCAATAATAGCAATAGATGCTTTAAAATTAAATGAATTCTATGGGA
ATGATGAATTAATTTTAGAACAGTTTTGGCTTGATGGGAATGTAGCCATCTTAGCCTTTA
CAGCTATTAAATCCTAGCATGATTATTCCTTCTGGAAAAAAATAAAAATATGATTTTCTT
GAGTTTCCACCATCCAGTTAGCATGAATTTCGCGCAATTTTATTAGATTATTTTTTGAGT
GATTTATTTGATTACCCAATGCACTCAGCTGAGTTGTTTGAGAATTTCATAGAGGCCTTC
AGTGATATTAAAGATTCTTCTTCATTTATTAAGAAATTAGAATTAATACCTTTGTTACAA
GAATTAAATGACAAGAAAGCCATCAAGCTAGAAACATGTGCTGTCGGAACTAAATTGTTT
GATTTCATCGTAGATATTAACAAGGATAAAATTAAATAACTATCAAGAGAATTTTCGAAA
GATAGACCAAAGTTCATGCCTATCCTTGATAAAAAGCCTCAACCTTCCTCTTCAAAGACA
AATAGCAGCTCAACAACAGCTCCACCAAAACAAGCAATATCAAAAAGAGAAATCGAAGAT
TTATTAAAGAAAGAAACGGGTCTTCAAAAGGAAGTTATTACACAAAGTAAAGAAAAAAGC
AATTTATTGAATAAGATTTCAGCAGCAGAAGAATCTGCATTAGCTATTTTCAGAAAGTAA
GGCTCTAGAAGAATAGATTACTGTGATTGTGGTACAAGAGATAAGTGTATATAAATAAGA
AATTCCACAGTGCCTTGCAACAAAGCGCACTTCAGAAAGATAATTCGTCCTCATACAGAT
GAAAATTTAGGAAACTGTTCTTATTTAGATACTTGCAGGCATATGGATTACTGCAAATTC
GTTCATTATGAATTAGATGTGGATATAAATAACATGAATAACGATAATCTTTTGCTAGAT
GGAATTGAAAAAAAACTCAATCCTTAATGGATTAACTGCGATCTAAGACAAATAGATTTT
AATATTTTGGGTAAATTCAACTGTATAATGGCTGATCCTCCTTGGGATATTCATATGACT
CTTCCTTATGGTACATTGAAAGATAGAGAAATGAAAGCAATGAGAGTTGATTTACTTCAA
GAGGAAGGTGTTATCTTTTTATGGGTAACTGGCCGTGCTATGGAACTTGGTAGAGAGTGC
TTAACTAATTGGGGATATAGAAGAGTTGAAGAAATTATTTGGGTAAAAACAAATTAATTG
CAAAGAATTATAAGAACAGGAAGAACAGGCCACTGGCTGAACCACTCTAAAGAACATTGT
CTTGTAGGAATTAAAGGTAATCCTAAGATAAATAGAAAAATCGACTGTGATGTGATAGTC
TCAGAAGTTAGAGAAACAAGTAGAAAACCAGATGAGATTTACAATTTAATAGAAAGAATG
TGTCCTGGAGGGAAAAAAATAGAATTATTTGGTAGACCACACAACACTATGCCAGGTTGG
CTAACTCTTGGTAATTAGTTACCAGGAATTTATTTAGAAGATGAGGAAATTATAGAAAGA
TATATGGATGCTTATCCTGATTAAGATATAAGCAGAGAAACAATGGAAAGAAATAGAATT
AGAATGAAAAATGAAAATGATATTGACCATATTTATAATTCACATATACAAAATATTCCT
CCTTTTAAAACTAAATAGCTAACAAAAGATTTGCAACTTCAACAATAAAGCAGTAGTATG
CAAACTACTTAATAGTAAAGTAGTTCACAGATGATGCCTCAAATGTAATAACAGTAATCT
TCGCAATCTATAAACTCCAACACCGATTTATAAATGCATGGAAACGGATTGTACGAGCAA
GAATGA


>TTHERM_00962190(protein)
MGSSVKDQEISNKKHKARNSSSGANNNSNSSNYQSSKRDIHQDRSYSKDDSQSRQYNSNN
GGGGSSSKNSNRNSSQQGYNQNSSSNQGQNSEYGGSGSGKNSQANSQRNSSQQGLQQLNQ
QQQSQQQQQQMLQNQMNSMGMMNQFQNSFGLMGMQPSQPLQLLNPSMIIPSGKKQKYDFL
EFPPSSQHEFRAILLDYFLSDLFDYPMHSAELFENFIEAFSDIKDSSSFIKKLELIPLLQ
ELNDKKAIKLETCAVGTKLFDFIVDINKDKIKQLSREFSKDRPKFMPILDKKPQPSSSKT
NSSSTTAPPKQAISKREIEDLLKKETGLQKEVITQSKEKSNLLNKISAAEESALAIFRKQ
GSRRIDYCDCGTRDKCIQIRNSTVPCNKAHFRKIIRPHTDENLGNCSYLDTCRHMDYCKF
VHYELDVDINNMNNDNLLLDGIEKKLNPQWINCDLRQIDFNILGKFNCIMADPPWDIHMT
LPYGTLKDREMKAMRVDLLQEEGVIFLWVTGRAMELGRECLTNWGYRRVEEIIWVKTNQL
QRIIRTGRTGHWLNHSKEHCLVGIKGNPKINRKIDCDVIVSEVRETSRKPDEIYNLIERM
CPGGKKIELFGRPHNTMPGWLTLGNQLPGIYLEDEEIIERYMDAYPDQDISRETMERNRI
RMKNENDIDHIYNSHIQNIPPFKTKQLTKDLQLQQQSSSMQTTQQQSSSQMMPQMQQQQS
SQSINSNTDLQMHGNGLYEQE


>TTHERM_00962190(gene)
ATGGGAAGCTCTGTAAAAGATTAGGAAATATCAAATAAAAAGCACAAGGCTCGTAATTCT
AGCAGTGGAGCCAATAACAATAGCAATAGCAGTAATTATTAAAGCAGTAAAAGAGACATT
CATTAAGACCGCAGTTATTCGAAGGATGACAGTCAAAGCAGGTAATACAATAGTAACAAC
GGCGGCGGAGGATCAAGCTCTAAAAATAGCAATCGTAACTCATCACAATAGGGTTATAAT
TAGAATTCTTCATCAAATCAAGGATAGAATTCCGAATATGGAGGATCTGGTTCAGGGAAA
AATTCTTAAGCAAATTCATAGAGAAATTCCTCTTAATAAGGATTGTAGTAGTTAAATTAG
CAGTAGTAATCTTAGCAATAATAGCAATAGATGCTTTAAAATTAAATGAATTCTATGGGA
ATGATGAATTAATTTTAGAACAGTTTTGGCTTGATGGGAATGTAGCCATCTTAGCCTTTA
CAGCTATTAAATCCTAGCATGATTATTCCTTCTGGAAAAAAATAAAAATATGATTTTCTT
GAGTTTCCACCATCCAGTTAGCATGAATTTCGCGCAATTTTATTAGATTATTTTTTGAGT
GATTTATTTGATTACCCAATGCACTCAGCTGAGTTGTTTGAGAATTTCATAGAGGCCTTC
AGTGATATTAAAGATTCTTCTTCATTTATTAAGAAATTAGAATTAATACCTTTGTTACAA
GAATTAAATGACAAGAAAGCCATCAAGCTAGAAACATGTGCTGTCGGAACTAAATTGTTT
GATTTCATCGTAGATATTAACAAGGATAAAATTAAATAACTATCAAGAGAATTTTCGAAA
GATAGACCAAAGTTCATGCCTATCCTTGATAAAAAGCCTCAACCTTCCTCTTCAAAGACA
AATAGCAGCTCAACAACAGCTCCACCAAAACAAGCAATATCAAAAAGAGTATTTTTTACA
AAAATTTATATTGATTAATATAAATGTTATTTGTTAGTTTGTTCGCTCTAAGTATGACAA
TTTATTTACTTATTAAAAGGAAATCGAAGATTTATTAAAGAAAGAAACGGGTCTTCAAAA
GGAAGTTATTACACAAAGTAAAGAAAAAAGCAATTTATTGAATAAGATTTCAGCAGCAGA
AGAATCTGCATTAGCTATTTTCAGAAAGTAAGGCTCTAGAAGAATAGATTACTGTGATTG
TGGTACAAGAGATAAGTGTATATAAATAAGAAATTCCACAGTGCCTTGCAACAAAGCGCA
CTTCAGAAAGATAATTCGTCCTCATACAGATGAAAATTTAGGAAACTGTTCTTATTTAGA
TACTTGCAGGCATATGGATTACTGCAAATTCGTTCATTATGAATTAGATGTGGATATAAA
TAACATGAATAACGATAATCTTTTGCTAGATGGAATTGAAAAAAAACTCAATCCTTAATG
GATTAACTGCGATCTAAGACAAATAGATTTTAATATTTTGGGTAAATTCAACTGTATAAT
GGCTGATCCTCCTTGGGATATTCATATGACTCTTCCTTATGGTACATTGAAAGTAAGAAA
TAAATTAATATAAGTTATTGCTTTAAAATCTATTCAGAATTTTCGATGGGATATATTCAT
TTAATAATATGAAAGTTCATTAATGAGTTTGAAAATATAGCAGAAAGCTACATTTTCTTT
TAAGATATTCGCAATAGAATTAGATATTAATTAAAATAGTTGCATTTTATTTGTTTTAAA
GTTAGATTTTACAAAACTCCTTTTAACAATGAAATAGCTTTTAAATGAAGAAATTAATGA
AATTTTATTTACTTATTTTTATAAATAATAAAAGGATAGAGAAATGAAAGCAATGAGAGT
TGATTTACTTCAAGAGGAAGGTGTTATCTTTTTATGGGTAACTGGCCGTGCTATGGAACT
TGGTAGAGAGTGCTTAACTAATTGGGGATATAGAAGAGTTGAAGAAATTATTTGGGTAAA
AACAAATTAATTGCAAAGAATTATAAGAACAGGAAGAACAGGCCACTGGCTGAACCACTC
TAAAGAACATTGTCTTGTAGGAATTAAAGGTAATCCTAAGATAAATAGAAAAATCGACTG
TGATGTGATAGTCTCAGAAGTTAGAGAAACAAGTAGAAAACCAGATGAGATTTACAATTT
AATAGAAAGAATGTGTCCTGGAGGGAAAAAAATAGAATTATTTGGTAGACCACACAACAC
TATGCCAGGTTGGCTAACTCTTGGTAATTAGTTACCAGGAATTTATTTAGAAGATGAGGA
AATTATAGAAAGATATATGGATGCTTATCCTGATTAAGATATAAGCAGAGAAACAATGGA
AAGAAATAGAATTAGAATGAAAAATGAAAATGATATTGACCATATTTATAATTCACATAT
ACAAAATATTCCTCCTTTTAAAACTAAATAGCTAACAAAAGATTTGCAACTTCAACAATA
AAGCAGTAGTATGCAAACTACTTAATAGTAAAGTAGTTCACAGATGATGCCTCAAATGTA
ATAACAGTAATCTTCGCAATCTATAAACTCCAACACCGATTTATAAATGTAAGCTTTTCA
CATGATTTCATCAGAATTTCTAAGATTATCTTTTTCGAAAAAAGGCATGGAAACGGATTG
TACGAGCAAGAATGA