Identifiers and Description

Gene Model Identifier

TTHERM_00548140

Standard Name

IMB4 (Importin Beta 4)

Aliases

PreTt15063 | 71.m00190 | 3729.m00067

Description

Importin-beta N-terminal domain containing protein;

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( PF02985 ) HEAT repeat
  • ( PF01602 ) Adaptin N terminal region
  • ( PF03130 ) PBS lyase HEAT-like repeat
  • ( PF03810 ) Importin-beta N-terminal domain
  • ( PF06827 ) Zinc finger found in FPG

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.4%

TetraMine Data

TTHERM_00548140

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_17057.19.997093137033517e-262hypothetical protein (1087 aa)
DictyBaseDDB_G02703362.0004062814618821e-57ipo4 on chromosome: 1 position
4662405 to 4666147
Stentor CoeruleusSteCoe_56146.054601895401186e-39
SGDYER110C4.000352986427571e-28KAP123 Karyopherin beta, media
tes nuclear import of ribosoma
l proteins prior to assembly i
nto ribosomes and import of hi
stones H3 and H4; localizes to
the nuclear pore, nucleus, an
d cytoplasm; exhibits genetic
interactions with RAI1
OxytrichaContig12471.0.0.g1072.000769134519826e-18hypothetical protein
WormBaseWBGene000020770.00000000009998509410508463locus:imb-3 status:Confirmed
UniProt:Q9N5V3 protein_id
:CCD67936.1

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:18676955: Malone CD, Falkowska KA, Li AY, Galanti SE, Kanuru RC, LaMont EG, Mazzarella KC, Micev AJ, Osman MM, Piotrowski NK, Suszko JW, Timm AC, Xu MM, Liu L, Chalker DL (2008) Nucleus-specific importin alpha proteins and nucleoporins regulate protein import and nuclear division in the binucleate Tetrahymena thermophila. Eukaryotic cell 7(9):1487-99

Sequences

>TTHERM_00548140(coding)
ATGAGCGGAACTCCTGAAATCACTAACTTAGATTAGGCCATTGAAGTTATGAATGGTATT
CTTAGTGGTAATAACGAAAAGATTAAGATTGGTACTAAGTTGTTGAAGCATTTTTGCAAG
AAGACTGATTCCATCAGTATCTTCACTTACATTTTGGCTCATTGCCAATAAGATAACTTG
AGACACTTAGCTGGTATTTTATTAAAGAGAAACATGATCGCTAATTTCTCTAACTTGGCA
GAACAAGCTTAAAAAGATTTACAAATGGTTCTCTTAGAAAGATTCTTTTCTGAATCAATG
AAATCCGTTCGTAAATCTATCGGTGCCTTGATTGGTATCATTGCTAAGCTTACCCTTCCC
GAAGGAAAGTGGGCTGAACTCTTATAAGTCATCCAACAACATACCGACAAGTCATAAACT
CTTTAAAACAGAATTTACGGTCTCTAACTTCTTGAGTTAGTCCTCGATTATTCAGCTTCT
TCTATTTCTAGCTTCTACAACAATTTCTACCCCTTCTTCAAGGAATCTATTCAAGACTCT
AATAAGGACATCAGAATTGGTACCCTCAAGTGCTTAGTTAACCTTTTCGATAACATCCAA
GATATGACTGCTGACCAAATTAACTTATATAAAGAATTGGTTGGTCCTATCTTGAATATC
TTAGATTCTTTGATAGATCAAAATGACGAAGACTTAGTTTACTACTGCTTTGATGCTTTG
AATCTTTTAACTGAAAATAAGAAAAGTATTCTCGACCAACATTTGGGTCAAATCGTTGAA
TATATGTGCTCAAATAAGGTTTTAGGAAATCCCAAGCTTTCTAAGAAGATCAAAGAAGTC
GTTATTGATATGATTTTCTCTGCATCCTAATACCATAAATCTGTTTTCAACAAGAATACT
CCCTTATTGAAGAAAGTTATTGAATCTATTTGCCTTATTATTGCTACTCCTTTCTCTGAA
GAAGATTTAGAAGATGGTGAAGAACCCTTATAAGATATTGCTTTATGGTTAGTTTTATCT
TTGAGCATGGTTTTGAATAAGAAGAAAACTTACGGTGTCCTCTTGGAAGCTATCACTGCT
TTAATTCACTCTGGTGAACCCAATAAAATGAACAGTGGTTTCCTCATTTTGGCTTAATTA
GCTGAAGGTTGCTACGAATAAATTGCCAGAAACTTAGCTAATCCTATTATGAGTGACTTC
ATGGTTAAGGGTTTGAATCACCCTGCTGGTGAAGTTAGAGGTGCTGCTATTAAAGCTTTG
ACTTACTTCGCTGAATACTTGCCCGTTGATGTTTGCAAATATCATAGCACTATCGTTCCC
GCCATTATCAGTACCTTCGATGATCTCAATAACAAGGTTGCTGAAAAAGCCATTATTGCT
ATTGATATCTTCTGCGATAACTTAGAACCTGAAGATTTAGAATTATACATGTAATCCATC
ACTGAAAAGTTATGCATGATTGCTATGAAGGATAACTCTACTATGTTAATGAGAAGAGTT
TCAGTTAGTGCTCTCGCTTCTTGCATTTCTACTGTTGAACACAAATTCAAGCCTTTCGTT
ACTGTTGTTGCTAATTTAATGCACTAAATTATTGGACTTGCACACAATGCTGAAGTCATC
GCTTTAAAGGCAGAAGCTATCAACTGCTTAGGTAAAATTGCTGCCGCCTTCATTTCTGAA
GACAGATCTATCTATGAGCAACACGTCGTTCCTTGCTTAGAAACTATTTACCACTTATTA
ACTACTGTTGATGACTTTGAAATGAGAGAAGGTTGTTTCTCATTCTTCTACAATCTCGCT
CACGCCATCGGCAGTGAATTCGAAGTCATGTTCGATAAGCTCATCGAATTTACTCTTAAG
TAAGCTGCCAGTGAAGAAGGTGTCACTTACAACAAAAACGGTAAGAACGGTGAATTCTCA
CTTGACTCCGATAGCGAAGAAGAAGATGAAGATTTGCTTGAAGACGAAGACCACAATACT
GCTGTCAACATCAAAACTGCCTTTGTTTTAGAAAAATCTGCTGCCATCACTGCTGTTGGT
CAATTCGCAGTTGCATGCCCTATGAAGTTTATTCCTTACTACGAAAAAGCCTTATCCATT
CTTGAAACTTGCTACAATTATTTCGACGAAAATGTCCGTCAATAAGTCTGCAAATGCTAC
AAGGATCTCTGTGTTGCCATGGTTAAAACTGCCAATAATGGTGTTCTTCCCAAGTTCGAA
AGAGGTCTCCCCGTTAAGGCTCGTTTCCCTGAAAAGATTGAAAACGTTATTCAAATTGAC
ATCTTCTAGAAATTCTTGTACTATCTCAACTAAGAAGAAGCCTGCGAAGTCACTGGTATG
GCTATTGAAATTATTGTTGAATTATTTAAGACACTTGGTCCTGCTTGCTTTGATAAAAAC
TTAGACGATATTTCTAATGCTATCGTTAAGCTTTTAGAAAACGAAAGCGAAGATGATGAA
CTTGGTGGTGATGATGAAGAAGATGAAGACGATGCTGATGGATACGTTATTGAAGCTCTC
ACTGACTTAATTCCTACTTTGTGCAAGCTCTGTGGTGATACTTTTAGCTTAAACTTCTAA
AAGATCTACCCTTCCATGATGAAATACCTTAACCCCAAGAGAGATATCAGCGAAAATATC
TATATGGTTGGTTGTTTCTCTGAAGTCATGAAATATACTCCTAATTTCCTCCTCTTCACC
AGAGAAACTCTTATTCCCACTTTGTTAGAAAAGGTCTAATACGGTGATGATGAAATGAAT
AGAAACCTTGCTTTCTGTCTTGGTAACATTGTTGAAAAGGGTCTCAACCACGTCTAAGAA
GCTCTTCCTACCATTCTCAATATCTTAAAGAATATCTTTGAAACATCAGTTGAATAAGCC
ACTAAGGACAATGCTGCTGCTGCCCTCTGCAGAGTTATGATGACTATTCCTGACTAGTTC
CCTCTTGATGCTGCTCTTGATTAAATTCTTTCTATCGCTCCCTTCTAAGGTGATGAAGCT
GAAGAAAAGACTGTCATTAGAACCCTCCTTTTCCTTGCAGAAAAGTATCCTTAAGTTATT
ACTCCCAAGATCAACAAAGCCATCGCTCTTTTCGTTGATGGTCTTGCTAACCTCAAATTA
TACAACATTAAGGATGAATTAAAGGGTAAAATTGTTCTCCTTCTTAAGAACCTTGCTAAC
AACTCTGCTGAACACAAAGCTCAATTAGAATAGGTTGTCTTCGCTAGTGAAGAAAAGGAA
AAGCTTATCAAGTTATTATAATGA


>TTHERM_00548140(protein)
MSGTPEITNLDQAIEVMNGILSGNNEKIKIGTKLLKHFCKKTDSISIFTYILAHCQQDNL
RHLAGILLKRNMIANFSNLAEQAQKDLQMVLLERFFSESMKSVRKSIGALIGIIAKLTLP
EGKWAELLQVIQQHTDKSQTLQNRIYGLQLLELVLDYSASSISSFYNNFYPFFKESIQDS
NKDIRIGTLKCLVNLFDNIQDMTADQINLYKELVGPILNILDSLIDQNDEDLVYYCFDAL
NLLTENKKSILDQHLGQIVEYMCSNKVLGNPKLSKKIKEVVIDMIFSASQYHKSVFNKNT
PLLKKVIESICLIIATPFSEEDLEDGEEPLQDIALWLVLSLSMVLNKKKTYGVLLEAITA
LIHSGEPNKMNSGFLILAQLAEGCYEQIARNLANPIMSDFMVKGLNHPAGEVRGAAIKAL
TYFAEYLPVDVCKYHSTIVPAIISTFDDLNNKVAEKAIIAIDIFCDNLEPEDLELYMQSI
TEKLCMIAMKDNSTMLMRRVSVSALASCISTVEHKFKPFVTVVANLMHQIIGLAHNAEVI
ALKAEAINCLGKIAAAFISEDRSIYEQHVVPCLETIYHLLTTVDDFEMREGCFSFFYNLA
HAIGSEFEVMFDKLIEFTLKQAASEEGVTYNKNGKNGEFSLDSDSEEEDEDLLEDEDHNT
AVNIKTAFVLEKSAAITAVGQFAVACPMKFIPYYEKALSILETCYNYFDENVRQQVCKCY
KDLCVAMVKTANNGVLPKFERGLPVKARFPEKIENVIQIDIFQKFLYYLNQEEACEVTGM
AIEIIVELFKTLGPACFDKNLDDISNAIVKLLENESEDDELGGDDEEDEDDADGYVIEAL
TDLIPTLCKLCGDTFSLNFQKIYPSMMKYLNPKRDISENIYMVGCFSEVMKYTPNFLLFT
RETLIPTLLEKVQYGDDEMNRNLAFCLGNIVEKGLNHVQEALPTILNILKNIFETSVEQA
TKDNAAAALCRVMMTIPDQFPLDAALDQILSIAPFQGDEAEEKTVIRTLLFLAEKYPQVI
TPKINKAIALFVDGLANLKLYNIKDELKGKIVLLLKNLANNSAEHKAQLEQVVFASEEKE
KLIKLLQ


>TTHERM_00548140(gene)
ATGAGCGGAACTCCTGAAATCACTAACTTAGATTAGGCCATTGAAGTTATGAATGGTATT
CTTAGTGGTAATAACGAAAAGATTAAGATTGGTACTAAGTTGTTGAAGCATTTTTGCAAG
AAGACTGATTCCATCAGTATCTTCACTTACATTTTGGCTCATTGCCAATAAGATAACTTG
AGACACTTAGCTGGTATTTTATTAAAGAGAAACATGATCGCTAATTTCTCTAACTTGGCA
GAACAAGCTTAAAAAGATTTACAAATGGTTCTCTTAGAAAGATTCTTTTCTGAATCAATG
AAATCCGTTCGTAAATCTATCGGTGCCTTGATTGGTATCATTGCTAAGCTTACCCTTCCC
GAAGGAAAGTGGGCTGAACTCTTATAAGTCATCCAACAACATACCGACAAGTCATAAACT
CTTTAAAACAGAATTTACGGTCTCTAACTTCTTGAGTTAGTCCTCGATTATTCAGCTTGT
AATATATTGTTTATTTCATAGCTTTTTGTTCAATTTTTTAGATTTTTAGTGGTCATTATT
CATCTTCTACTTTTTAGAAGCAAATATCTGCAACAAGGCTTATTTTTAAACAAGCTAGTC
ATACTTTTAAAGCAGGAAAAAAATGATAACTTTAAATTACTTCAAAAATTAATAGCTAAC
TATTCAAATTATAAAAAATAGCTTCTATTTCTAGCTTCTACAACAATTTCTACCCCTTCT
TCAAGGAATCTATTCAAGACTCTAATAAGGACATCAGAATTGGTACCCTCAAGTGCTTAG
TTAACCTTTTCGATAACATCCAAGATATGACTGCTGACCAAATTAACTTATATAAAGAAT
TGGTTGGTCCTATCTTGAATATCTTAGATTCTTTGATAGATCAAAATGACGAAGACTTAG
TTTACTACTGCTTTGATGCTTTGAATCTTTTAACTGAAAATAAGGTAAATAAATAAACAA
ATATTTCTAACTAAAAATATAAATGAAGATAATCTAAATCATAGGCTAACTAACTAGCTG
ACTATCAGCAAATAAAATCATGTTAAATATTTTTAAAATGAAAAAGCATACTAAGAACAA
TGCAAATAATAGAAAAATTTGAGGAAATATATTTTAAAATTTAGATATAAATTAATTTCA
CTCAAACATTAAACAAATATCTTAATTTTGCAAACAAACAAAGAAAGATATATAAAAATT
AATAAATTAGTTAATTTTGCAACCATTCAAAAAATCAATATTACAAATCTTTGCTATTCA
AAAAAATAATTAAATTACACATTCAAGAATGAAATAATTATACCTAATTCCGCGAAAATT
AAATAAATAAATAAATATACAAAGCATATTTAGTTAGATAAATAGCTTGTTTGCTTAGAT
TTTCTTTTCATTTAAATATTTAATTTAAAATTAAATGATTTATTTAATATAAAACAGAAA
AGTATTCTCGACCAACATTTGGGTCAAATCGTTGAATATATGTGCTCAAATAAGGTTTTA
GGAAATCCCAAGCTTTCTAAGAAGATCAAAGAAGTCGTTATTGATATGATTTTCTCTGCA
TCCTAATACCATAAATCTGTTTTCAACAAGAATACTCCCTTATTGAAGAAAGTTATTGAA
TCTATTTGCCTTATTATTGCTACTCCTTTCTCTGAAGAAGATTTAGAAGATGGTGAAGAA
CCCTTATAAGATATTGCTTTATGGTTAGTTTTATCTTTGAGCATGGTTTTGAATAAGAAG
AAAACTTACGGTGTCCTCTTGGAAGCTATCACTGCTTTAATTCACTCTGGTGAACCCAAT
AAAATGAACAGTGGTTTCCTCATTTTGGCTTAATTAGCTGAAGGTTGCTACGAATAAATT
GCCAGAAACTTAGCTAATCCTATTATGAGTGACTTCATGGTTAAGGGTTTGAATCACCCT
GCTGGTGAAGTTAGAGGTGCTGCTATTAAAGCTTTGACTTACTTCGCTGAATACTTGCCC
GTTGATGTTTGCAAATATCATAGCACTATCGTTCCCGCCATTATCAGTACCTTCGATGAT
CTCAATAACAAGGTTGCTGAAAAAGCCATTATTGCTATTGATATCTTCTGCGATAACTTA
GAACCTGAAGATTTAGAATTATACATGTAATCCATCACTGAAAAGTTATGCATGATTGCT
ATGAAGGATAACTCTACTATGTTAATGAGAAGAGTTTCAGTTAGTGCTCTCGCTTCTTGC
ATTTCTACTGTTGAACACAAATTCAAGCCTTTCGTTACTGTTGTTGCTAATTTAATGCAC
TAAATTATTGGACTTGCACACAATGCTGAAGTCATCGCTTTAAAGGCAGAAGCTATCAAC
TGCTTAGGTAAAATTGCTGCCGCCTTCATTTCTGAAGACAGATCTATCTATGAGCAACAC
GTCGTTCCTTGCTTAGAAACTATTTACCACTTATTAACTACTGTTGATGACTTTGAAATG
AGAGAAGGTTGTTTCTCATTCTTCTACAATCTCGCTCACGCCATCGGCAGTGAATTCGAA
GTCATGTTCGATAAGCTCATCGAATTTACTCTTAAGTAAGCTGCCAGTGAAGAAGGTGTC
ACTTACAACAAAAACGGTAAGAACGGTGAATTCTCACTTGACTCCGATAGCGAAGAAGAA
GATGAAGATTTGCTTGAAGACGAAGACCACAATACTGCTGTCAACATCAAAACTGCCTTT
GTTTTAGAAAAATCTGCTGCCATCACTGCTGTTGGTCAATTCGCAGTTGCATGCCCTATG
AAGTTTATTCCTTACTACGAAAAAGCCTTATCCATTCTTGAAACTTGCTACAATTATTTC
GACGAAAATGTCCGTCAATAAGTCTGCAAATGCTACAAGGATCTCTGTGTTGCCATGGTT
AAAACTGCCAATAATGGTGTTCTTCCCAAGTTCGAAAGAGGTCTCCCCGTTAAGGCTCGT
TTCCCTGAAAAGATTGAAAACGTTATTCAAATTGACATCTTCTAGAAATTCTTGTACTAT
CTCAACTAAGAAGAAGCCTGCGAAGTCACTGGTATGGCTATTGAAATTATTGTTGAATTA
TTTAAGACACTTGGTCCTGCTTGCTTTGATAAAAACTTAGACGATATTTCTAATGCTATC
GTTAAGCTTTTAGAAAACGAAAGCGAAGATGATGAACTTGGTGGTGATGATGAAGAAGAT
GAAGACGATGCTGATGGATACGTTATTGAAGCTCTCACTGACTTAATTCCTACTTTGTGC
AAGCTCTGTGGTGATACTTTTAGCTTAAACTTCTAAAAGATCTACCCTTCCATGATGAAA
TACCTTAACCCCAAGAGAGATATCAGCGAAAATATCTATATGGTTGGTTGTTTCTCTGAA
GTCATGAAATATACTCCTAATTTCCTCCTCTTCACCAGAGAAACTCTTATTCCCACTTTG
TTAGAAAAGGTCTAATACGGTGATGATGAAATGAATAGAAACCTTGCTTTCTGTCTTGGT
AACATTGTTGAAAAGGGTCTCAACCACGTCTAAGAAGCTCTTCCTACCATTCTCAATATC
TTAAAGAATATCTTTGAAACATCAGTTGAATAAGCCACTAAGGACAATGCTGCTGCTGCC
CTCTGCAGAGTTATGATGACTATTCCTGACTAGTTCCCTCTTGATGCTGCTCTTGATTAA
ATTCTTTCTATCGCTCCCTTCTAAGGTGATGAAGCTGAAGAAAAGACTGTCATTAGAACC
CTCCTTTTCCTTGCAGAAAAGTATCCTTAAGTTATTACTCCCAAGATCAACAAAGCCATC
GCTCTTTTCGTTGATGGTCTTGCTAACCTCAAATTATACAACATTAAGGATGAATTAAAG
GGTAAAATTGTTCTCCTTCTTAAGAACCTTGCTAACAACTCTGCTGAACACAAAGCTCAA
TTAGAATAGGTTGTCTTCGCTAGTGAAGAAAAGGAAAAGCTTATCAAGTTATTATAATGA