Identifiers and Description

Gene Model Identifier

TTHERM_00335950

Standard Name

IMA3 (Importin Alpha 3)

Aliases

PreTt06038 | 34.m00275 | 3689.m00072

Description

Armadillo/beta-catenin-like repeat family protein; Karyopherin/Importin alpha family member

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Domains

  • ( PF04764 ) Protein of unknown function (DUF613)
  • ( PF05316 ) Mitochondrial ribosomal protein (VAR1)

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.8%

TetraMine Data

TTHERM_00335950

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_16092.15.998566275848171e-59hypothetical protein (353 aa)
WormBaseWBGene000020740.00000000039982266684865623locus:ima-3 Importin subunit
alpha-3 status:Confirmed
UniProt:Q19969 protein_id:CC
D70435.1
OxytrichaContig20249.0.g400.0000000029989608248573072Armadillo/beta-catenin-like re
peat
DictyBaseDDB_G02723180.000000019990673443141236DDB_G0272318 on chromosome: 2
position 1278811 to 1280712

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:18676955: Malone CD, Falkowska KA, Li AY, Galanti SE, Kanuru RC, LaMont EG, Mazzarella KC, Micev AJ, Osman MM, Piotrowski NK, Suszko JW, Timm AC, Xu MM, Liu L, Chalker DL (2008) Nucleus-specific importin alpha proteins and nucleoporins regulate protein import and nuclear division in the binucleate Tetrahymena thermophila. Eukaryotic cell 7(9):1487-99

Sequences

>TTHERM_00335950(coding)
ATGGAATAAATTGATAAATTAACAAGCTATCAAAGCGAATAAAATGATTAGAACGAACAG
TAGCACGAACAAGAAGAATATGATTATAGGGATATCATTTCTAAAAAGAAAGAAAACTAT
AGAGTAGAAATTAGAAAAAAGAAAATGAATGAATTATTAGCTAAGTCGAGAAGTAAACCA
ATTTTAGCAATTAATAAAGAATTTGTGCATAGGACTACTTTCAACAATTAAGAAGATAGA
ATGTTATATGTTTAGCAATTATTAAATTCTATTCAAGCATCATTATAGCAGGCTAGAATT
GAGTTAAACGAATAGCTCATTGAACAAATGAATGATTATTGTACATATATTATAGAAACT
GTCATAGATATAAAATCTAACGACTAATACCTTATTGAGTAGACATTAAAACTTGGCACT
ATTGATGTGATACTACCTATTTTAGAAGAAGAAATTTTTAAAGAATTTATTTATTTACAA
AGCAATGTATATAACTTATTAGGATCTCTCTTCTATGCAGATAACTAAATTCTTTAAAGT
TATATCAATAACAGAGTAGTCAATGTTGTGCTAAATTCACTTGTATCAAACGAATCTACT
ATAATAGAATATGGATTGTTTATGACAGGAAACTTAATTTCAGGAAACAAGAAATTAAAA
GAAATGCTATATGAGCAAAATTTAATTGATATTTTATTCTAAATTCATTCTCTCGATAAG
CTTAATACAGATAATTATGGATAATTATACTATGAAGGAATCAAAGATTACATATGGCTA
ATATCTGTTTTTCTAGAAAAAAATTAAGGAAAATTTAAGAGCAAAATATGCACAAAAGAT
TTTAAAAAGCTTATAGAAATAAGTTTCGATTTAGCTTGTGATGAAAAGTTTTATGAATCA
TAGGACGTTAAAACAACAAGAAATCTTGTTCTTAATATTTTAGATTCTGTAAACACTTAA
GATGCACTTATTAGTTATTTCTATTAGCTGCAAAAAATAAAAAATGTCAATTTGATAGAA
AGATTCTTATTTATTATGAATAATTGCTCAAAATTTGATATTATTGTTGTTTAAATAATA
TCTAGATTTATATTTAACGTAATCGCTGGACCTGATGAGTTCTGTGAAGATCTGCTTAAT
TAAAATATCTTAGATGCCTTTAAACTCTTATATGAATATTATAGAGATAGTCATATATTT
AAAGCAGAAATAGCTTGGTCAGTCAGTAATATTTGCACTAATTCAAAATACATAGAATAT
GTCATGGACCATCCAATATATAAATTATTTTTAGATACTTTTGATTATTAAAGCAGTGAT
GTAAAAAGAGAAATTCTGTATGTGGCAATATAAGTTTTTAAGGGAGGAAATCATAATTAA
ATGAAAAAAATTATTTCAAGTGATTTTATGGGAAAATATATCAGGTCTATGAATACATAA
GATACAAGATTAATCCTAGGTCTTTTGGAAGGAATTGACTATTTATTGCATTCATTTGCT
TAAATTTTTACAGCTGATGGTGAGAATGTCATCCTTAGTTCATTAGAGAAATACAATTTG
TCTGGAATGCTTTAAGAATTATAGAGCCATAAAAGTGAATCTGTTTATAGTTCTGTAGCA
AAAATAATCTAAAATCATTTCTAGTACTCTGACTGA


>TTHERM_00335950(protein)
MEQIDKLTSYQSEQNDQNEQQHEQEEYDYRDIISKKKENYRVEIRKKKMNELLAKSRSKP
ILAINKEFVHRTTFNNQEDRMLYVQQLLNSIQASLQQARIELNEQLIEQMNDYCTYIIET
VIDIKSNDQYLIEQTLKLGTIDVILPILEEEIFKEFIYLQSNVYNLLGSLFYADNQILQS
YINNRVVNVVLNSLVSNESTIIEYGLFMTGNLISGNKKLKEMLYEQNLIDILFQIHSLDK
LNTDNYGQLYYEGIKDYIWLISVFLEKNQGKFKSKICTKDFKKLIEISFDLACDEKFYES
QDVKTTRNLVLNILDSVNTQDALISYFYQLQKIKNVNLIERFLFIMNNCSKFDIIVVQII
SRFIFNVIAGPDEFCEDLLNQNILDAFKLLYEYYRDSHIFKAEIAWSVSNICTNSKYIEY
VMDHPIYKLFLDTFDYQSSDVKREILYVAIQVFKGGNHNQMKKIISSDFMGKYIRSMNTQ
DTRLILGLLEGIDYLLHSFAQIFTADGENVILSSLEKYNLSGMLQELQSHKSESVYSSVA
KIIQNHFQYSD


>TTHERM_00335950(gene)
ATGGAATAAATTGATAAATTAACAAGCTATCAAAGCGAATAAAATGATTAGAACGAACAG
TAGCACGAACAAGAAGAATATGATTATAGGGATATCATTTCTAAAAAGAAAGAAAACTAT
AGAGTAGAAATTAGAAAAAAGAAAATGAATGAATTATTAGCTAAGTCGAGAAGTAAACCA
ATTTTAGCAATTAATAAAGAATTTGTGCATAGGACTACTTTCAACAATTAAGAAGTACTC
ACTTGTTTATTCAATCAACAGTTAAAATATTTACTTTTTTTTTGCTTTAGGATAGAATGT
TATATGTTTAGCAATTATTAAATTCTATTCAAGCATCATTATAGCAGGCTAGAATTGAGT
TAAACGAATAGCTCATTGAACAAATGAATGATTATTGTACATATATTATAGAAACTGTCA
TAGATATAAAATCTAACGACTAATACCTTATTGAGTAGACATTAAAACTTGGCACTATTG
ATGTGATACTACCTATTTTAGAAGAAGAAATTTTTAAAGAATTTATTTATTTACAAAGCA
ATGTATATAACTTATTAGGATCTCTCTTCTATGCAGATAACTAAATTCTTTAAAGTTATA
TCAATAACAGAGTAGTCAATGTTGTGCTAAATTCACTTGTATCAAACGAATCTACTATAA
TAGAATATGTAATAAACGATTAAATAAACTGAAGTTTATTCATTTAATAATTTAAAAGGG
ATTGTTTATGACAGGAAACTTAATTTCAGGAAACAAGAAATTAAAAGAAATGCTATATGA
GCAAAATTTAATTGATATTTTATTCTAAATTCATTCTCTCGATAAGCTTAATACAGATAA
TTATGGATAATTATACTATGAAGGAATCAAAGATTACATATGGCTAATATCTGTTTTTCT
AGAAAAAAATTAAGGAAAATTTAAGAGCAAAATATGCACAAAAGATGTAATTTGTTTGTT
TTTAATATTTATGTTAAATTAATTTTTAACTCAAATACTTATATCAAATAGTTTAAAAAG
CTTATAGAAATAAGTTTCGATTTAGCTTGTGATGAAAAGTTTTATGAATCATAGGACGTT
AAAACAACAAGAAATCTTGTTCTTAATATTTTAGATTCTGTAAACACTTAAGATGCACTT
ATTAGTTATTTCTATTAGCTGCAAAAAATAAAAAATGTCAATTTGATAGAAAGATTCTTA
TTTATTATGAATAATTGCTCAAAATTTGATATTATTGTTGTTTAAATAATATCTAGATTT
ATATTTAACGTAATCGCTGGACCTGATGAGTTCTGTGAAGATCTGCTTAATTAAAATATC
TTAGATGCCTTTAAACTCTTATATGAATATTATAGAGATAGTCATATATTTAAAGCAGAA
ATAGCTTGGTCAGTCAGTAATATTTGCACTAATTCAAAATACATAGAATATGTCATGGAC
CATCCAATATATAAATTATTTTTAGATACTTTTGATTATTAAAGCAGTGATGTAAGCAAA
TATTTTATAATAACAATACTTTATTTTAATTTTTTAATACTTAGGTAAAAAGAGAAATTC
TGTATGTGGCAATATAAGTTTTTAAGGGAGGAAATCATAATTAAATGAAAAAAATTATTT
CAAGTGATTTTATGGGAAAATATATCAGGTCTATGAATACATAAGATACAAGATTAATCC
TAGGTCTTTTGGAAGGAATTGACTATTTATTGCATTCATTTGCTTAAATTTTTACAGCTG
ATGGTGAGAATGTCATCCTTAGTTCATTAGAGAAATACAATTTGTCTGGAATGCTTTAAG
AATTATAGAGCCATAAAAGTGAATCTGTTTATAGTTCTGTAGCAAAAATAATCTAAAATC
ATTTCTAGTACTCTGACTGA