Identifiers and Description

Gene Model Identifier

TTHERM_00295520

Standard Name

IMA10 (Importin Alpha 10)

Aliases

PreTt15662 | 27.m00322 | 3692.m00125

Description

Armadillo/beta-catenin-like repeat family protein; Karyopherin/Importin alpha family member

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Domains

  • ( PF02985 ) HEAT repeat
  • ( PF08210 ) APOBEC-like N-terminal domain
  • ( PF00514 ) Armadillo/beta-catenin-like repeat

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.7%

TetraMine Data

TTHERM_00295520

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_08817.19.997093137033517e-262armadillo/beta-catenin repeat
family protein (540 aa)
OxytrichaContig20249.0.g409.997975313387782e-28Armadillo/beta-catenin-like re
peat
WormBaseWBGene000020742.000769134519826e-18locus:ima-3 Importin subunit
alpha-3 status:Confirmed
UniProt:Q19969 protein_id:CC
D70435.1
DictyBaseDDB_G02723184.0009493637353324e-18DDB_G0272318 on chromosome: 2
position 1278811 to 1280712
SGDYNL189W0.00000000000006002591555650462SRP1 Karyopherin alpha homolog
, forms a dimer with karyopher
in beta Kap95p to mediate impo
rt of nuclear proteins, binds
the nuclear localization signa
l of the substrate during impo
rt; may also play a role in re
gulation of protein degradatio
n

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:18676955: Malone CD, Falkowska KA, Li AY, Galanti SE, Kanuru RC, LaMont EG, Mazzarella KC, Micev AJ, Osman MM, Piotrowski NK, Suszko JW, Timm AC, Xu MM, Liu L, Chalker DL (2008) Nucleus-specific importin alpha proteins and nucleoporins regulate protein import and nuclear division in the binucleate Tetrahymena thermophila. Eukaryotic cell 7(9):1487-99

Sequences

>TTHERM_00295520(coding)
ATGATTGAAGATAGTAACATAGATGATAGCAAATTAAAAAACTATTTAGAACCCTAAAAT
GATGAAGAAGAAGAGGAACCTATAGAAAAAATGATTATCAACAAGAAGAGAGAAAATTTT
TAAGTTTAAATAAGGAACTCTAAAAAGAAATAAATCTTGCAAAATAACAGAGTAAAAATG
TACTAAAAATATGTTAAAGAAATCATACATGAAAATGGAGAGTAATCTTAGTCTATTAAA
TCTATGATACCAGAACATATTCTTTAAAGCCCTTAAAAATTACAAATATACCTTAACCAG
TTTATTGAAGATTTCAAAAAGGAGTTTGAAAATTACAATCCTCAAGATTATAGTGCACTT
TTTAAGAGTTTAAACCATTTGCGTTAGTTTAGTTTTTTATAATAATCAGCTTCTGTTATC
ACATAACTTATTCAAAGCAATTTACATAATATTTTGATATAACTTATAAGTCCTGATTTT
GATAGCTAACTAAGATATGAAGCTGCTTGGCTTTTGACTAATTGCCTAGCAGCATCAAAC
TGCGAAGATTTAGATTTTATTACGAGAAATAATTATGTTAACATTTTAGAAGCATTTGCC
TCTCTTTACTAATTATGGGATAATGAAAAGTTATTTGAAATTGGTATTTGGGGTTTGACA
AATTTATGTGTAGATATAAAAGAGGCAGCAGAACTTTTCTACTAGAAATACGGATTTGAA
AAGATTGAAGAAAAGTTTATCACCTACCAAAATAACATAGACATTTAGGAAAATTTATCT
TGGATGATGACAGTGTTCTCATAATATAATAAAATATTTACAAAAGCAGATAAAATGACT
TTTCTTAAATTAGCAGAAAAGTAAGTAATGCAAAATACTAATTCTTCGATACAACACTAT
GGGATTAGGATTATTTATTAACTGACTATTGATGATGATTGCTGCCAAGCAATAGTAAAA
AGAGAAAAGCTTATTGATTTTTTATTATAGCTTACACATAACTCCTAATATATTAGTTAT
GTGATTGGTATTATGGGGAATATAATTGCTTGCCAATATGAAGTTTCATAAATTTTAATG
AATCATAACATTTTAGAATATCTCTCTATAGCTCTAGATAATGTTAGAGTTGATGTGAGA
AAAGAGTCTATGTGGTGCATAGCTAATTTATTGACAGGATCTGAAGAGGAAATTTAATAA
ATTTTAGATTATAATAGATTAATTGAAAAAGTATTTAGAATAGCAAGAATTGATACAATT
TAAGTTATATATGAAGTATGCATGGGATTGGTTAATTGCTTGGTGAAGGCTAATAATTTT
TAGATAATGAAGTTAGTATAAATGGGAATTTTAGAAATTTTTGTATCATTTTTTATGATT
TAGGATGTGAATATTGTCACAAAAACACTTTAAGGAGTAGGATTCCTCCTAGATTATGGA
TAAAATATTAAATAATCAGACTAAGAAAATCCTATAAAATCAAATTTATAATAGCTTGGA
TTTAACCAAATTCTCTCTTCATTATAATGTCATCCTCATGACATAGTTTATGATTTATCT
ACAGAAATATTAAATGAACATTACTCATCTGATATTAAAAACCAATAATTAACTAATAAT
AATTAAATGGAGGAGTGTGAAATATGA


>TTHERM_00295520(protein)
MIEDSNIDDSKLKNYLEPQNDEEEEEPIEKMIINKKRENFQVQIRNSKKKQILQNNRVKM
YQKYVKEIIHENGEQSQSIKSMIPEHILQSPQKLQIYLNQFIEDFKKEFENYNPQDYSAL
FKSLNHLRQFSFLQQSASVITQLIQSNLHNILIQLISPDFDSQLRYEAAWLLTNCLAASN
CEDLDFITRNNYVNILEAFASLYQLWDNEKLFEIGIWGLTNLCVDIKEAAELFYQKYGFE
KIEEKFITYQNNIDIQENLSWMMTVFSQYNKIFTKADKMTFLKLAEKQVMQNTNSSIQHY
GIRIIYQLTIDDDCCQAIVKREKLIDFLLQLTHNSQYISYVIGIMGNIIACQYEVSQILM
NHNILEYLSIALDNVRVDVRKESMWCIANLLTGSEEEIQQILDYNRLIEKVFRIARIDTI
QVIYEVCMGLVNCLVKANNFQIMKLVQMGILEIFVSFFMIQDVNIVTKTLQGVGFLLDYG
QNIKQSDQENPIKSNLQQLGFNQILSSLQCHPHDIVYDLSTEILNEHYSSDIKNQQLTNN
NQMEECEI


>TTHERM_00295520(gene)
ATGATTGAAGATAGTAACATAGATGATAGCAAATTAAAAAACTATTTAGAACCCTAAAAT
GATGAAGAAGAAGAGGAACCTATAGAAAAAATGATTATCAACAAGAAGAGAGAAAATTTT
TAAGTTTAAATAAGGAACTCTAAAAAGAAATAAATCTTGCAAAATAACAGAGTAAAAATG
TACTAAAAATATGTTAAAGAAATCATACATGAAAATGGAGAGTAATCTTAGTCTATTAAA
TCTATGATACCAGAACATATTCTTTAAAGCCCTTAAGTATCCGAATAAAAATTAAGAATA
TTTGATAATTTTATTAATTTATTTATAAATAGAAATTACAAATATACCTTAACCAGTTTA
TTGAAGATTTCAAAAAGGAGTTTGAAAATTACAATCCTCAAGATTATAGTGCACTTTTTA
AGAGTTTAAACCATTTGCGTTAGTTTAGTTTTTTATAATAATCAGCTTCTGTTATCACAT
AACTTATTCAAAGCAATTTACATAATATTTTGATATAACTTATAAGTCCTGATTTTGATA
GCTAACTAAGATATGAAGCTGCTTGGCTTTTGACTAATTGCCTAGCAGCATCAAACTGCG
AAGATTTAGATTTTATTACGAGAAATAATTATGTTAACATTTTAGAAGCATTTGCCTCTC
TTTACTAATTATGGGATAATGAAAAGTTATTTGAAATTGTAAATAAGCTTAATTTAAATA
TCTTTATACTATTCATTTTTTCATTAAAATTCAGGGTATTTGGGGTTTGACAAATTTATG
TGTAGATATAAAAGAGGCAGCAGAACTTTTCTACTAGAAATACGGATTTGAAAAGATTGA
AGAAAAGTTTATCACCTACCAAAATAACATAGACATTTAGGAAAATTTATCTTGGATGAT
GACAGTGTTCTCATAATATAATAAAATATTTACAAAAGTAATTAAGAATATTCAATGCCA
TTATTTTATAATAAATCCTTTCATTTTGTTTATTTATTAGGCAGATAAAATGACTTTTCT
TAAATTAGCAGAAAAGTAAGTAATGCAAAATACTAATTCTTCGATACAACACTATGGGAT
TAGGATTATTTATTAACTGACTATTGATGATGATTGCTGCCAAGCAATAGTAAAAAGAGA
AAAGCTTATTGATTTTTTATTATAGCTTACACATAACTCCTAATATATTAGTTATGTGAT
TGGTATTATGGGGAATATAATTGCTTGCCAATATGAAGTTTCATAAGTAAATTATTAATG
GCAGTTTAATTTTATTTACTTGAACATATTAATTTATTAATAGATTTTAATGAATCATAA
CATTTTAGAATATCTCTCTATAGCTCTAGATAATGTTAGAGTTGATGTGAGAAAAGAGTC
TATGTGGTGCATAGCTAATTTATTGACAGGATCTGAAGAGGAAATTTAATAAATTTTAGA
TTATAATAGATTAATTGAAAAAGTATTTAGAATAGCAAGAATTGATACAATTTAAGTAAG
CTCTATTGAAATGAAACTATCTAATATATTTTTTTAATTAGGTTATATATGAAGTATGCA
TGGGATTGGTTAATTGCTTGGTGAAGGCTAATAATTTTTAGATAATGAAGTTAGTATAAA
TGGGAATTTTAGAAATTTTTGTATCATTTTTTATGATTTAGGATGTGAATATTGTCACAA
AAACACTTTAAGGAGTAGGATTCCTCCTAGATTATGGATAAAATATTAAATAATCAGACT
AAGAAAATCCTATAAAATCAAATTTATAATAGCTTGGATTTAACCAAATTCTCTCTTCAT
TATAATGTCATCCTCATGACATAGTTTATGATTTATCTACAGAAATATTAAATGAACATT
ACTCATCTGATATTAAAAACCAATAATTAACTAATAATAATTAAATGGAGGAGTGTGAAA
TATGA