Identifiers and Description

Gene Model Identifier

TTHERM_00492850

Standard Name

ILS1 (IsoLeucine-tRNA Synthetase 1 )

Aliases

PreTt04221 | 61.m00208 | cupC | 3711.m00056 | ILSA

Description

ilsA isoleucyl-tRNA synthetase protein; Isoleucyl-tRNA synthetase; contains two C-terminal leucine zipper motifs and sequence similarity with the S.cerevisiae ileRS protein; transcript induced during meitoic prophase and nutritional shift-up but decreased by starvation

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 13.8%

TetraMine Data

TTHERM_00492850

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Stentor CoeruleusSteCoe_97950
WormBaseWBGene000021529.997093137033517e-262locus:iars-1 Isoleucine--tRN
A ligase, cytoplasmic status
:Partially_confirmed UniProt
:Q21926 protein_id:CAA94369.
1
Tetrahymena borealisEI9_12981.19.997093137033517e-262isoleucyl-tRNA synthetase (110
1 aa)
DictyBaseDDB_G02782939.997093137033517e-262ileS on chromosome: 3 position
632971 to 636359
OxytrichaContig21964.0.g219.997093137033517e-262tRNA synthetases class I (I, L
, M and V)
SGDYBL076C9.997093137033517e-262ILS1 Cytoplasmic isoleucine-tR
NA synthetase, target of the G
1-specific inhibitor reveromyc
in A

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:1371507: Csank C, Martindale DW (1992) Isoleucyl-tRNA synthetase from the ciliated protozoan Tetrahymena thermophila. DNA sequence, gene regulation, and leucine zipper motifs. The Journal of biological chemistry 267(7):4592-9
  2. Ref:2663194: Martindale DW, Gu ZM, Csank C (1989) Isolation and complete sequence of the yeast isoleucyl-tRNA synthetase gene (ILS1). Current genetics 15(2):99-106
  3. Ref:3005971: Martindale DW, Martindale HM, Bruns PJ (1986) Tetrahymena conjugation-induced genes: structure and organization in macro- and micronuclei. Nucleic acids research 14(3):1341-54
  4. Ref:6646127: Martindale DW, Bruns PJ (1983) Cloning of abundant mRNA species present during conjugation of Tetrahymena thermophila: identification of mRNA species present exclusively during meiosis. Molecular and cellular biology 3(10):1857-65

Sequences

>TTHERM_00492850(coding)
ATGATTCTTTTCAAAAAATTATTAATATAAAAAAAAGTAAATTATCTAAGCAGATTATTA
ATGGCTTCAAAGACCACCTTCAAAGATCTTTAGGAAATTCCTGATTTCCCTAAGGAAGAA
GAGAACATCCTCAAGTTTTGGGATGAAATTAATGCTTTTAAGCAACAATTAGAAAAAACT
AAGGATTGCCCTCCTTTCACTTTCTACGATGGCCCACCATTCGCTACCGGTTTACCTCAC
TATGGTAACCTTCTTGCTGGTACAATCAAGGATGTCGTTTGCAGATACGCTTCTCAAAAT
GGCAAATATGTTGAAAGAAGATTCGGTTGGGATTGTCACGGTCTTCCAGTTGAATATGAA
ATCGATAAGAAGCTCGGTATCACCAATAGACAAGAAGTCTTAAAGATGGGTGTCGACAAG
TACAATGCTGAATGCCGTAGCATCGTCATGAGATACGCTTAAGAATGGAGATCAATCGTG
AACAGATTTGGTCGTTGGGTTGACTTTGACAATGATTACAAAACTCTTGATTTGAAGTTT
ATGGAATCCGTTTGGTGGGTTTTCAAGCAAATGTTCGATAAGGGATTAGTTTATAGAGGT
TGCAAGGTTATGCCCTACTCCAATGGTTGTGCAACTGTCTTATCTAACTTCGAAACTCAA
CAAAACTACAAGGAAGTTGATGATCCTTCTCTCTTCATCGCTTTTAAGACTGCCGAAGAT
CCTAAGACCAAGTTCATTGCTTGGACAACCACTCCTTGGACACTTCCTTCTAACTTGGCT
TTGGTTATCAACAAGGACTTCGATTACGTTAAGGTTTTAGATGCTAAGACCTAAGAACAC
TACATTCTTGCAGAATGCCGTCTCCCTGAATTATACAAAAAGGATAAGGATGGATACAAG
ATCTTAGAAAAATTCAAAGGTTCTGAACTCGTAGGCAGAGAATATGAACCTCTTTTCCCC
TATTTCCTCTCTAGAAAGCAAGATGGCTGCTTCAGAATTCTCGCTGGTGACTTCGTTACT
GCTGATGCTGGTACTGGTATCGTCCACTGCGCCCCTGGTTTTGGTGATGACGATTACAAA
GTCTCAGTTGCAAATAACATCATCAAGCCCGATGATCCACCCGTACCTGTTGATGAAAAC
GGTCATTTCACTAATGTCGTTTCTGATTTTGCTGGTGTTTACATCAAGGAAGCTGATAAG
TTAATTAGAAAGAACTTGAAGGAAAGAGGTTTGTTGCTCGTTGATTCTTCATTCAAGCAC
AACTATCCCTTCTGCTGGAGATCTGATACCCCCTTGATTTACAAGGCTGTTCACTGCTGG
TTCATTAAGGTTACTGCCCTTAAGGATGACCTTTTAGCTAACAACAAGAAGGCTTATTGG
GTTCCTAAATTTGCTTAAGAAGGACGTTTCAACAACTGGTTGTAGAATGTCTCTGATTGG
TGTTTCTCTAGATCTAGATTCTGGGGTAACCCTATCCCTATTTGGGTTTCTGAAGATTTT
GAAGAAGTTGTTTGCATTGGATCAGTTGAAGAACTCAAGAAATTAACTGGTGCAACTGAA
ATCACTGATTTACACAAAGATTTTATTGATCACCTTACCATCCCATCCTAAAAGGGTAAG
GGGGTCTTAAGACGTATTGATGAAGTCTTTGATTGCTGGTTCGAATCTGGTTCTATGCCT
TATGGTCAATAACACTATCCCTTCTCTATGAACGAAGAAGAGTTCTCTAAGAGATTCCCT
GCTGATTTCATCGGTGAAGGTATTGATCAAACTAGAGGTTGGTTCTATACTCTTAACGTT
ATTTCTACTGCCTTAAGAAATTCCAACCCCTACAAAAACCTTATTGTTAACGGTATCGTT
CTTGCTGCTGACGGAAAGAAGATGTCTAAGTCAAAGAAGAACTACGATGATCCCTTGCTC
ATTGCCTCCAAGTACTCCGTTGATGCTATCCGTTTATATATGATCAACTCTCCTTTAGTC
AGAGCTGAAGAAATGAGTTTCAAGTCCGAAGGTGTTTTTGCTGTTAAGAAAGATATCTTC
TTACCCTGGTACAATGCTTACAAATTCTTAATCTAAAGTATCACTAGATGGGAACTCGCT
ACTGGAAAAGACTACATGTTCAACGAACAACTCTCTGTTGATACTACTAAATTAACTAAT
CCTACTGATAGATGGATTATTATCTCCTGCCAAAACTTGATCAACTATGTCAGAATTGAA
ATGGAAAAGTATCACTTGTACAATGTCGTTCCTCGTTTAATCCACTTCTTAGAAAACTTA
ACCAACTGGTATATTAGATTAAACAGAAACAGACTAAAAGGTGATTACGGTCTTGAAGAA
TAAGAAACTTCCCTCAACGTCTTATTCAACGTTATCTTAAACTCCACTATTTTAATGTCA
CCTTTAGTTCCTTTCATCACTGAAAGTTTCTATCAAAACTTAAGAAAGGTCATTCCTAAG
GGTTCTTCTTACTTAGAAGAATCTATCCACTTCTTGAGAATCCCTACTCCTAAGCAAGAA
CTTCTCGATGAAAAGATCGAAAGAAACTTTGAAAGAATGTAAAACATCATCAACTTTGCT
CGTACTTTAAGAGAAAAGAGAAAGGTCTCTCTTAAGCAACCTATCATGTCTTTGACTGTC
ATCAATTAAGACTAAGAATTCCACGATTCCTTAAAGGATTACATTCAATATATTGAAGAT
GAAATCAACACTCCTTCTATCCTCCACGAAATTAACACTGCTAATTATGTTGACTTAAAG
GCCATTCCTAATCACAAACTCCTTGGACAAAAACTTGGTAAGGAATACAATAAGGATCTT
AAGGCTGCTGCCGGTAACTTGTCTGCCAAGGATATTGAAACCTTGAAGACTACTGGATCT
ATTGATTTAGTTGGCAAGAAATTACTTTTGGAAGACTTCACCATTACTCAAAATTACAAG
AAAGAATACTCTAGTGGTGACTTAGAACTTGGTGGTGAAGGTGAAGTTATTTTACTTTTG
AACCTCGCTCAAGATGAAAAGTTAAAGAGCAAAGGTCTTGTTAGAGAATTTACCAGCAAC
GTTTAAAAGACCAAGAAGAAAACCGGCTTAAAGGTTGACGATAACATCGTTATTTATTAT
GATGTTACCAAAGCACCCAAGTTAAATGCTGCTATTTAATCCGATTTAGAAGCTGTCCAA
AAGGTCTTAAAGAAACCCCTCGTTCCTTTATCTGAAAAGAATGCTGCTCTTAAGATTGTT
GAAAACTCTTTACTTACTTTCTAGGTTGATGAAGAATCCGTTACTATCGAAATCGCTTAT
GCTTGA


>TTHERM_00492850(protein)
MILFKKLLIQKKVNYLSRLLMASKTTFKDLQEIPDFPKEEENILKFWDEINAFKQQLEKT
KDCPPFTFYDGPPFATGLPHYGNLLAGTIKDVVCRYASQNGKYVERRFGWDCHGLPVEYE
IDKKLGITNRQEVLKMGVDKYNAECRSIVMRYAQEWRSIVNRFGRWVDFDNDYKTLDLKF
MESVWWVFKQMFDKGLVYRGCKVMPYSNGCATVLSNFETQQNYKEVDDPSLFIAFKTAED
PKTKFIAWTTTPWTLPSNLALVINKDFDYVKVLDAKTQEHYILAECRLPELYKKDKDGYK
ILEKFKGSELVGREYEPLFPYFLSRKQDGCFRILAGDFVTADAGTGIVHCAPGFGDDDYK
VSVANNIIKPDDPPVPVDENGHFTNVVSDFAGVYIKEADKLIRKNLKERGLLLVDSSFKH
NYPFCWRSDTPLIYKAVHCWFIKVTALKDDLLANNKKAYWVPKFAQEGRFNNWLQNVSDW
CFSRSRFWGNPIPIWVSEDFEEVVCIGSVEELKKLTGATEITDLHKDFIDHLTIPSQKGK
GVLRRIDEVFDCWFESGSMPYGQQHYPFSMNEEEFSKRFPADFIGEGIDQTRGWFYTLNV
ISTALRNSNPYKNLIVNGIVLAADGKKMSKSKKNYDDPLLIASKYSVDAIRLYMINSPLV
RAEEMSFKSEGVFAVKKDIFLPWYNAYKFLIQSITRWELATGKDYMFNEQLSVDTTKLTN
PTDRWIIISCQNLINYVRIEMEKYHLYNVVPRLIHFLENLTNWYIRLNRNRLKGDYGLEE
QETSLNVLFNVILNSTILMSPLVPFITESFYQNLRKVIPKGSSYLEESIHFLRIPTPKQE
LLDEKIERNFERMQNIINFARTLREKRKVSLKQPIMSLTVINQDQEFHDSLKDYIQYIED
EINTPSILHEINTANYVDLKAIPNHKLLGQKLGKEYNKDLKAAAGNLSAKDIETLKTTGS
IDLVGKKLLLEDFTITQNYKKEYSSGDLELGGEGEVILLLNLAQDEKLKSKGLVREFTSN
VQKTKKKTGLKVDDNIVIYYDVTKAPKLNAAIQSDLEAVQKVLKKPLVPLSEKNAALKIV
ENSLLTFQVDEESVTIEIAYA


>TTHERM_00492850(gene)
ATGATTCTTTTCAAAAAATTATTAATATAAAAAAAAGTAAATTATCTAAGCAGATTATTA
ATGGCTTCAAAGACCACCTTCAAAGATCGTAATAATTACTTCTACTAATAAATATGCCTT
TTTCTATGAAAAACAAAATCTATAAATGTCCTAGAAATTAATATTTTCTTTTAATACTCA
TATAGTTTAGGAAATTCCTGATTTCCCTAAGGAAGAAGAGAACATCCTCAAGTTTTGGGA
TGAAATTAATGCTTTTAAGCAACAATTAGAAAAAACTAAGGATTGCCCTCCTTTCACTTT
CTACGATGGCCCACCATTCGCTACCGGTTTACCTCACTATGGTAACCTTCTTGCTGGTAC
AATCAAGGTATTTTATAAAAATTTTTATTTATTTCAGAAAATTCTATTTAGTTTTTTGCT
CTTGCCATGTTTATTTTTCTGAAATAAAATCCTGTGTACGAAAAAAAAAAAACAAATTGA
CTAAAATAATTATTTTATTGGAGTCAACACATTTTTTTTTTCATTTTTTAAACTTAAACT
GTTTCTGAATTACTTAAATAAATAATATTAATATATTTTTAAATGCTTATAGGATGTCGT
TTGCAGATACGCTTCTCAAAATGGCAAATATGTTGAAAGAAGATTCGGTTGGGATTGTCA
CGGTCTTCCAGTTGAATATGAAATCGATAAGAAGCTCGGTATCACCAATAGACAAGAAGT
CTTAAAGGTAATATTTAAGATAAAAATTAGCATTTTTAGTTAATTCGAACCCTAATTTGG
CATTAGATATATTTCGAATACCATATTTTGCAAAGATGAAAATATTCAATTAAATTAAGC
TTTTGAAAGTTTAATTAATAAATAGATACAGAATAATAAATAAAGTATAAATCTTAGAAA
AAATTGGCGCAACTTCAATTAAAAAAAAAATTTTCATTCTTTTTTTTAAACAAAATATAA
TTTTCTTACTCTAATAAATCTTAAATAGAAATACATTTAATCTAAAAAATTATTTATTTT
TATATTAGATGGGTGTCGACAAGTACAATGCTGAATGCCGTAGCATCGTCATGAGATACG
CTTAAGAATGGAGATCAATCGTGAACAGATTTGGTCGGTAATGAAACTTCCTATTTAAAT
ATCTTCTTTAATTAAAATAAATTATTAATTCTAATTCAATAAATAAGAAAGGAAAATAAC
TAACGAATTAGCTTTTTAAATAAGCAAAGAAAAATTAAAATTTTAAAAACATAATTAATT
ATAGAAAATATAAATTTAATTCAATATTTATTAATTAATTATATTATAGTTGGGTTGACT
TTGACAATGATTACAAAACTCTTGATTTGAAGTTTATGGAATCCGTTTGGTGGGTTTTCA
AGCAAATGTTCGATAAGGGATTAGTTTATAGAGGTTGCAAGGTTATGCCCTACTCCAATG
GTTGTGCAACTGTCTTATCTAACTTCGAAACTCAACAAAACTACAAGGAAGTTGATGATC
CTTCTCTCTTCATCGCTTTTAAGACTGCCGAAGATCCTAAGACCAAGTTCATTGCTTGGA
CAACCACTCCTTGGACACTTCCTTCTAACTTGGCTTTGGTTATCAACAAGGACTTCGATT
ACGTTAAGGTTTTAGATGCTAAGACCTAAGAACACTACATTCTTGCAGAATGCCGTCTCC
CTGAATTATACAAAAAGGATAAGGATGGATACAAGATCTTAGAAAAATTCAAAGGTTCTG
AACTCGTAGGCAGAGAATATGAACCTCTTTTCCCCTATTTCCTCTCTAGAAAGCAAGATG
GCTGCTTCAGAATTCTCGCTGGTGACTTCGTTACTGCTGATGCTGGTACTGGTATCGTCC
ACTGCGCCCCTGGTTTTGGTGATGACGATTACAAAGTCTCAGTTGCAAATAACATCATCA
AGCCCGATGATCCACCCGTACCTGTTGATGAAAACGGTCATTTCACTAATGTCGTTTCTG
ATTTTGCTGGTGTTTACATCAAGGAAGCTGATAAGTTAATTAGAAAGAACTTGAAGGAAA
GAGGTTTGTTGCTCGTTGATTCTTCATTCAAGCACAACTATCCCTTCTGCTGGAGATCTG
ATACCCCCTTGATTTACAAGGCTGTTCACTGCTGGTTCATTAAGGTTACTGCCCTTAAGG
ATGACCTTTTAGCTAACAACAAGAAGGCTTATTGGGTAATTATTTAGATTGACATTTAAA
AATATTATTTTACTTAAATTATTCCAAATATATTAATTAGGTTCCTAAATTTGCTTAAGA
AGGACGTTTCAACAACTGGTTGTAGAATGTCTCTGATTGGTGTTTCTCTAGATCTAGATT
CTGGGGTAACCCTATCCCTATTTGGGTTTCTGAAGATTTTGAAGAAGTTGTTTGCATTGG
ATCAGTTGAAGAACTCAAGAAATTAACTGGTGCAACTGAAATCACTGATTTACACAAAGA
TTTTATTGATCACCTTACCATCCCATCCTAAAAGGGTAAGGGGGTCTTAAGACGTATTGA
TGAAGTCTTTGATTGCTGGTTCGAATCTGGTTCTATGCCTTATGGTCAATAACACTATCC
CTTCTCTATGAACGAAGAAGAGTTCTCTAAGAGATTCCCTGCTGATTTCATCGGTGAAGG
TATTGATCAAACTAGAGGTTGGTTCTATACTCTTAACGTTATTTCTACTGCCTTAAGAAA
TTCCAACCCCTACAAAAACCTTATTGTTAACGGTATCGTTCTTGCTGCTGACGGAAAGAA
GATGTCTAAGTCAAAGAAGAACTACGATGATCCCTTGCTCATTGCCTCCAAGTACTCCGT
TGATGCTATCCGTTTATATATGGTATTTATTTTCTTCTTTTAATAAAACCAAATTAATCA
TTTTAATTCCTTATCCTAAAGATCAACTCTCCTTTAGTCAGAGCTGAAGAAATGAGTTTC
AAGTCCGAAGGTGTTTTTGCTGTTAAGAAAGATATCTTCTTACCCTGGTACAATGCTTAC
AAATTCTTAATCTAAAGTATCACTAGATGGGAACTCGCTACTGGAAAAGACTACATGTTC
AACGAACAACTCTCTGTTGATACTACTAAATTAACTAATCCTACTGATAGATGGATTATT
GTAAGAATATTAAAATAGCTATTTTTTAATTTTAAAACAACTTTTACAAATAGATCTCCT
GCCAAAACTTGATCAACTATGTCAGAATTGAAATGGAAAAGTATCACTTGTACAATGTCG
TTCCTCGTTTAATCCACTTCTTAGAAAACTTAACCAACTGGTATATTAGATTAAACAGAA
ACAGACTAAAAGGTGATTACGGTCTTGAAGAATAAGAAACTTCCCTCAACGTCTTATTCA
ACGTTATCTTAAACTCCACTATTTTAATGTCACCTTTAGTTCCTTTCATCACTGAAAGTT
TCTATCAAAACTTAAGAAAGGTCATTCCTAAGGGTTCTTCTTACTTAGAAGAATCTATCC
ACTTCTTGAGAATCCCTACTCCTAAGCAAGAACTTCTCGATGAAAAGATCGAAAGAAACT
TTGAAAGAATGTAAAACATCATCAACTTTGCTCGTACTTTAAGAGAAAAGAGAAAGGTCT
CTCTTAAGCAACCTATCATGGTAATATTCAACAATTTATTATTATTATTAATGGTAATTA
ATTTTTAAAATCAAAGTCTTTGACTGTCATCAATTAAGACTAAGAATTCCACGATTCCTT
AAAGGATTACATTCAATATATTGAAGATGAAATCAACACTCCTTCTATCCTCCACGAAAT
TAACACTGCTAATTATGTTGACTTAAAGGCCATTCCTAATCACAAACTCCTTGGACAAAA
ACTTGGTAAGGAATACAATAAGGATCTTAAGGCTGCTGCCGGTAACTTGTCTGCCAAGGA
TATTGAAACCTTGAAGACTACTGGATCTATTGATTTAGTTGGCAAGAAATTACTTTTGGA
AGACTTCACCATTACTCAAAATTACAAGAAAGAATACTCTAGTGGTGACTTAGAACTTGG
TGGTGAAGGTGAAGTTATTTTACTTTTGAACCTCGCTCAAGATGAAAAGTTAAAGAGCAA
AGGTCTTGTTAGAGAATTTACCAGCAACGTTTAAAAGACCAAGAAGAAAACCGGCTTAAA
GGTTGACGATAACATCGTTATTTATTATGATGTTACCAAAGCACCCAAGTTAAATGCTGC
TATTTAATCCGATTTAGAAGCTGTCCAAAAGGTCTTAAAGAAACCCCTCGTTCCTTTATC
TGAAAAGAATGCTGCTCTTAAGATTGTTGAAAACTCTTTACTTACTTTCTAGGTTGATGA
AGAATCCGTTACTATCGAAATCGCTTATGCTTGA