Identifiers and Description

Gene Model Identifier

TTHERM_00314860

Standard Name

IGR7 (Induced during Granule Regeneration )

Aliases

PreTt20896 | 31.m00198 | 3687.m00001

Description

Induced during dense core granule (DCG) regeneration; function unknown; transcription induced following exocytosis; may be cargo protein of dense core secretory granules

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( PF01461 ) 7TM chemoreceptor
  • ( PF07907 ) YibE/F-like protein
  • ( TIGR00518 ) alanine dehydrogenase
  • ( PF01791 ) Deoxyribose-phosphate aldolase
  • ( PF02233 ) NAD(P) transhydrogenase beta subunit
  • ( PF04976 ) DMSO reductase anchor subunit (DmsC)
  • ( PF07695 ) 7TM diverse intracellular signalling
  • ( PF06570 ) Protein of unknown function (DUF1129)
  • ( PF07690 ) transporter, major facilitator family
  • ( PF02687 ) efflux ABC transporter, permease protein
  • ( PF03653 ) Uncharacterised protein family (UPF0093)
  • ( PF05222 ) Alanine dehydrogenase/PNT, N-terminal domain
  • ( PF00107 ) oxidoreductase, zinc-binding dehydrogenase family
  • ( TIGR00561 ) NAD(P)(+) transhydrogenase (AB-specific), alpha subunit
  • ( PF01262 ) Alanine dehydrogenase/pyridine nucleotide transhydrogenase
  • ( TIGR02185 ) conserved hypothetical integral membrane protein
  • ( TIGR00136 ) tRNA uridine 5-carboxymethylaminomethyl modification enzyme

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00314860

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_08505.19.997093137033517e-262NAD transhydrogenase beta subu
nit protein (1236 aa)
Stentor CoeruleusSteCoe_275211.5007857627073948e-41
WormBaseWBGene000037784.999350823993609e-33locus:nnt-1 status:Partially
_confirmed UniProt:Q18031
protein_id:CCD64627.1
DictyBaseDDB_G02690461.9991517704232713e-32DDB_G0269046 on chromosome: 1
position 1853006 to 1856574

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:12456006: Haddad A, Bowman GR, Turkewitz AP (2002) New class of cargo protein in Tetrahymena thermophila dense core secretory granules. Eukaryotic cell 1(4):583-93

Sequences

>TTHERM_00314860(coding)
ATGTTAAGATAACACTAAGGTTCTTTTAAAACTAGAACCGGGCACTAAAAGCTAAAATTA
ATTGAAGAATAATCTCTTCCGCATGAGTCTTCTGAAGGATTACTTGATTATTTTAATTTT
TCAAGTATTAAAAAAAAATTATAATCTTGGTGTGATAGTATTGTAGACAATGATACAGTT
CATAGATTTTTGAGTAAAATTGGTCAAAAAGATGAAGATAAGGATAGTAATGACAAGAGT
TAAAAAAACTAAGATTCTAAAGGAGATGATAAAAAAGATAATTCAGATAATAAAGAATAA
GATGATAGTTCAACAAAGACTGATAATTCTAATAAAGAATTAAAAGTTAATAGAGTGACT
GATTTCCAAAACGCTTCATATTTTGCAGCAAGTTTTATGTTTATCTTAGCAATTTACTCT
TTCAGTTCTGCTAAGACAGCCAGAAGGGGAGTTTTTATTGGTTTAGGAGGTATGATTTTA
GCTATTTGGGCTTCATTCTTTTCAAGTACTTGGGATCTAGGAGATTCTTTCAGATGGTTA
GTTTCTTTTCTTGTAGGAGGAACTATAGGTTTATTTGCAGGTCTCAATGCCAAAATGTCA
CAAATAGGTTAAACTGTATGCTTACTTTAAGCTATGGTTGGGGCTGGTTGTTTTTTACTA
GGGTTAGCATAGTATGAACGTTACGAATATTTGAAAGTAGAATTTGAAGGCTTTGGATCT
ATTTAAACAGTAGTAGTATGCTGGTTGGGATCCACTCTCTTTTCATCTACTTTGACTTCT
TTCTATAAACTAGATAAAAAAAATCTGGCTAAAGCACCATTAGAAACAATTGGAAAGAAA
AGAGATTTATTTAACACAATCGTGATCATTAGTATTGTAGTTTTATCTATCCTTTACATC
TGGTTTAACTTTGGCTGGACTCTTTGGGTAATCATCTTCCTCTCTCTTTACATTGGTTGG
GGATTGACTGTTTCTGCTTAACCCAAAGAAATGAACATTGTTGTCCCTTGTTAAACCTTT
TTAACAGGTTTAACTATTGTTTTTGTTGGTTTTATGCTTGACAGACATTATTTATTGCTT
GTTGGAGCTCTTTGCATAACTGGTGGTTTATCACTTACTTTATAATCTGCCAAAGGATTG
AATGTAAAAGTTCACTAAGTTTTCTTCAAGAGCTGGTCAAAAAGCAATGCCGATTCAGAA
GCTTCATAAAACCATCACTTTGGATATCATAACTAACTCATCAACGAAAATGATTTAGCT
CATGAATTGCTTTATAATGATAAAATTGTTTTTGTCCCAGGAAATGGTATTTATCAAACG
AACTCTACTTAGGCATTAAGTGAAATTAGTTTTGCTCTTTAGCATTTAGGAAAGCATGTA
ACTTTCTGTGTTCACCCTTGTTCTGGCAGAATTCCTGGACATATTTAAGCAGTTTTAACT
TCATTTGATATCCCTTATTCTAAGATCAAGCAAATGAATGAGGTAGATTTTGCAGAATTT
GATCTTGCTGTTGTAATTGGAGCTTATGAAGAAGTTGATCCTGATAATTTGAATGACAGA
CAGAGCAGTAATTATAAAATGCCCACATGCAAAGTTTGGGAAGCCACTAAGGTTATTTAT
GTAGAAACTCAGATTGAAAAATATAAAGGAAATGGATTATTTGATAAGCAAAATATCTCC
GTTATGAAAGGAGATGCTAACAAACTTTTATCAAATATTGTTAAAGATTTCTAGAGAAAA
GGTTTCACTGATATGGATCCTGAAGAGAGAAGTCTTATTTTATAAGGAGTAGCTATTTAA
GCTCAATCCAATTTAATTCCTTAATAAACAGCCAATCCTGATGACTTAGAAGATCTTGTA
AAGAAGGCAACTAGAATTTTAGGTGTTTATAATGAATAATCTGAAAGCAACGAAACCAGA
GTGGCCATAACTCCATCTGCTGTTAAACCTTTACTGAAAAATGGAGTTCATGTTTGGATT
GAGAAAGATTCTGGAAAGTCAAGTGGATTTTCTGATGAATAGTATTACAAAGCTGGTGCA
AAAATAGCAACAGCAAATGAAATTTTCTAAAATGCAAATATTTTAGTTTTTATCTCTTAA
TTGAAAGATAAGTAAATTAACTAAATTGGTAAGGCTGTTGAGTTGCTAGTTGCTCCTCTT
GGAAAAGAAAAAAAATAAGTTGTTTCTAAGCTAGCTAAAAACGAAAAACTTACTGTTGTT
GATTTGAGTGATATTTCTCCTGAAGTTATACGTGCTTAAAAGCTAAGTACATCAGCTAAT
TAAGAAACCCTTTCATGTTACCGTTCAGTTTTTGAAGGTTTTTATCACTTAAACAAAATT
GCTCGCCCAGTTTATAATAGTACTGGAAGATCACCTGGTGCTCATGTCCTAGTTATAGGT
GCTGACCATTTAGGCTTAACAGTAGCTAGCATTGCTAAATAGTATGGTTCAATCGTAAGG
GTTTATGATAGAAGAGATGGATTGAAGCATTTAATTAAAAAAAGTGGTTTTATTCCAGTT
GAGTTTGTATATGAAATAGTAAATAATAGCCCAAATCATGTTGAAGAAGTTTAAAAGAAT
GCTCTTAAAGAAGTTCTCAAAACCACAGATCTTGTGATTACAGCTTCTTTCAAGGATGAT
GGATCTGCTACCAAAGTCTTAAATGAGGAATTATGCAGTTTGTTAAGAAGAGGGTCTGTT
ATTGTAGACTTAGCAGCTGAAAAGGGGGGCAATACTTCTTTAACTTAGTTAGATAAAGTT
AACCACGATGTAAATTTAGGTATTCATGTTATTGGTTACAGCTTTGGTAGCTATTGCTAG
AAACTCAATAGATAATCTAGTGAACTCCACTCTCTAAGCATCAACCACCTTTTCAATTAG
ATTTTCTTAAATAAAAATTTAGAACTTGGCTTGGTTGATTTACAAGATGAAACATTAAGA
GAAGTCTGTTACTTACACACCGGAAAAGATGTATCAGATAGATCATTTAAAAAGCACTAA
CATGATCATGAGAAATTAGCTAACGAAAGTGAAATCCCTGATTAATCTGAGCAAAAATTA
GTTGAAAAATAAGATAAAGAAAGCGATAGAAAGAGTATTGACATTCAGCATTCAGAAGCT
TCTGTCCATTTAGATGGAAACAATGATAAAATTTCAGAGGAAAATAAGGAAAAAACATTT
GGAGAAAAGTTCAAAAATACTCTTAAGAAAACCGGAGAATATTATGAAAATTCCAAAGAG
TATGTTCTTAACTTTGTTAGCGACTAATTCAGTGAAAAAAGAGAAGAAGAAATCAACAAG
AATCCTGGTGTTTTTGCTACTTTATTTACTGTGTTTGTACTTATCTTCTGTCTTTTCTTG
GGAGTTTTAACTGACAGTGAATTCATTTTCCAATTAGGACTTTTCATTCTTGCTTTATTT
GTTGGTGATACTGTAATTAAATAAGTTGATCCTGGTTTGAATGGACCTTTGCTATTATTT
TTGTAAACATTGAGTGGAAGCATTGGAATAGCCTGCATGCTTATCTTCTCATAAGAAGAT
AATGTTGCTTTCTTTTCAGCCTTTACAATAATTGCTACTGTTGGAAACATGCTAGCTATG
GCTTGTGTTGTAGGAGGCTTTGCACTAACAATCAGGGCTGTTACTAACTTTACTCCAAGA
GAATACAGATAAATAGATAACTCTGAATGA


>TTHERM_00314860(protein)
MLRQHQGSFKTRTGHQKLKLIEEQSLPHESSEGLLDYFNFSSIKKKLQSWCDSIVDNDTV
HRFLSKIGQKDEDKDSNDKSQKNQDSKGDDKKDNSDNKEQDDSSTKTDNSNKELKVNRVT
DFQNASYFAASFMFILAIYSFSSAKTARRGVFIGLGGMILAIWASFFSSTWDLGDSFRWL
VSFLVGGTIGLFAGLNAKMSQIGQTVCLLQAMVGAGCFLLGLAQYERYEYLKVEFEGFGS
IQTVVVCWLGSTLFSSTLTSFYKLDKKNLAKAPLETIGKKRDLFNTIVIISIVVLSILYI
WFNFGWTLWVIIFLSLYIGWGLTVSAQPKEMNIVVPCQTFLTGLTIVFVGFMLDRHYLLL
VGALCITGGLSLTLQSAKGLNVKVHQVFFKSWSKSNADSEASQNHHFGYHNQLINENDLA
HELLYNDKIVFVPGNGIYQTNSTQALSEISFALQHLGKHVTFCVHPCSGRIPGHIQAVLT
SFDIPYSKIKQMNEVDFAEFDLAVVIGAYEEVDPDNLNDRQSSNYKMPTCKVWEATKVIY
VETQIEKYKGNGLFDKQNISVMKGDANKLLSNIVKDFQRKGFTDMDPEERSLILQGVAIQ
AQSNLIPQQTANPDDLEDLVKKATRILGVYNEQSESNETRVAITPSAVKPLLKNGVHVWI
EKDSGKSSGFSDEQYYKAGAKIATANEIFQNANILVFISQLKDKQINQIGKAVELLVAPL
GKEKKQVVSKLAKNEKLTVVDLSDISPEVIRAQKLSTSANQETLSCYRSVFEGFYHLNKI
ARPVYNSTGRSPGAHVLVIGADHLGLTVASIAKQYGSIVRVYDRRDGLKHLIKKSGFIPV
EFVYEIVNNSPNHVEEVQKNALKEVLKTTDLVITASFKDDGSATKVLNEELCSLLRRGSV
IVDLAAEKGGNTSLTQLDKVNHDVNLGIHVIGYSFGSYCQKLNRQSSELHSLSINHLFNQ
IFLNKNLELGLVDLQDETLREVCYLHTGKDVSDRSFKKHQHDHEKLANESEIPDQSEQKL
VEKQDKESDRKSIDIQHSEASVHLDGNNDKISEENKEKTFGEKFKNTLKKTGEYYENSKE
YVLNFVSDQFSEKREEEINKNPGVFATLFTVFVLIFCLFLGVLTDSEFIFQLGLFILALF
VGDTVIKQVDPGLNGPLLLFLQTLSGSIGIACMLIFSQEDNVAFFSAFTIIATVGNMLAM
ACVVGGFALTIRAVTNFTPREYRQIDNSE


>TTHERM_00314860(gene)
ATGTTAAGATAACACTAAGGTTCTTTTAAAACTAGAACCGGGCACTAAAAGCTAAAATTA
ATTGAAGAATAATCTCTTCCGCATGAGTCTTCTGAAGGATTACTTGATTATTTTAATTTT
TCAAGTATTAAAAAAAAATTATAATCTTGGTGTGATAGTATTGTAGACAATGATACAGTT
CATAGATTTTTGAGTAAAATTGGTCAAAAAGATGAAGATAAGGATAGTAATGACAAGAGT
TAAAAAAACTAAGATTCTAAAGGAGATGATAAAAAAGATAATTCAGATAATAAAGAATAA
GATGATAGTTCAACAAAGACTGATAATTCTAATAAAGAATTAAAAGTTAATAGAGTGACT
GATTTCCAAAACGCTTCATATTTTGCAGCAAGTTTTATGTTTATCTTAGCAATTTACTCT
TTCAGTTCTGCTAAGACAGCCAGAAGGGGAGTTTTTATTGGTTTAGGAGGTATGATTTTA
GCTATTTGGGCTTCATTCTTTTCAAGTACTTGGGATCTAGGAGATTCTTTCAGATGGTTA
GTTTCTTTTCTTGTAGGAGGAACTATAGGTTTATTTGCAGGTCTCAATGTAATAATAAAT
TTTTTACTAAATCACAACAAAAATAACAAGCAAATAAATAATTACGTTTTTTATATCTTA
CATTAAATCCTTATTTATTATTCTTGTTCTCTCATTTAGAATGGATATTTTATAATTTTA
ACTAAAATATTTTTATTATAATCTAATTATTAGGCCAAAATGTCACAAATAGGTTAAACT
GTATGCTTACTTTAAGCTATGGTTGGGGCTGGTTGTTTTTTACTAGGGTTAGCATAGTAT
GAACGTTACGAATATTTGAAAGTAGAATTTGAAGGCTTTGGATCTATTTAAACAGTAGTA
GTATGCTGGTTGGGATCCACTCTCTTTTCATCTACTTTGACTTCTTTCTATAAACTAGAT
AAAAAAAATCTGGCTAAAGCACCATTAGAAACAATTGGAAAGAAAAGAGATTTATTTAAC
ACAATCGTGATCATTAGTATTGTAGTTTTATCTATCCTTTACATCTGGTTTAACTTTGGC
TGGACTCTTTGGGTAATCATCTTCCTCTCTCTTTACATTGGTTGGGGATTGGTAAAATTA
TTAGATTTAATTCAAATAAAAAAATAATTTTGAAAAAATAGTTTTAATTTATTAATTGAT
TATTTTAAAAAAATTATAAATATTTCATTTTAAAATAGACTGTTTCTGCTTAACCCAAAG
AAATGAACATTGTTGTCCCTTGTTAAACCTTTTTAACAGGTTTAACTATTGTTTTTGTTG
GTTTTATGCTTGACAGACATTATTTATTGCTTGTTGGAGCTCTTTGCATAACTGGTGGTT
TATCACTTACTTTATAATCTGCCAAAGGATTGAATGTAAAAGTTCACTAAGTTTTCTTCA
AGAGCTGGTCAAAAAGCAATGCCGATTCAGAAGCTTCATGTATAATTTTTTTATTTTTTA
TTAATTTAAAAAATTAAATTAATAATACAGAAAACCATCACTTTGGATATCATAACTAAC
TCATCAACGAAAATGATTTAGCTCATGAATTGCTTTATAATGATAAAATTGTTTTTGTCC
CAGGAAATGGTATTTATCAAACGAACTCTACTTAGGCATTAAGTGAAATTAGTTTTGCTC
TTTAGCATTTAGGAAAGCATGTAACTTTCTGTGTTCACCCTTGTTCTGGCAGAATTCCTG
GTAACATATTTATAAATGACCAAGCAGCAATTAATTAAATAAATAAATTATTTTTTTAAA
AGGACATATTTAAGCAGTTTTAACTTCATTTGATATCCCTTATTCTAAGATCAAGCAAAT
GAATGAGGTAGATTTTGCAGAATTTGATCTTGCTGTTGTAATTGGAGCTTATGAAGAAGT
TGATCCTGATAATTTGAATGACAGACAGAGCAGTAATTATAAAATGCCCACATGCAAAGT
TTGGGAAGCCACTAAGGTTATTTATGTAGAAACTCAGATTGAAAAATATAAAGGAAATGG
ATTATTTGATAAGCAAAATATCTCCGTTATGAAAGGAGATGCTAACAAACTTTTATCAAA
TATTGTTAAAGATTTCTAGAGAAAAGGTTTCACTGATATGGATCCTGAAGAGAGAAGTCT
TATTTTATAAGGAGTAGCTATTTAAGCTCAATCCAATTTAATTCCTTAATAAACAGCCAA
TCCTGATGACTTAGAAGATCTTGTAAAGAAGGCAACTAGAAGTAAATAAAATTAAAAAAA
AAATAAAAAAAATAATAATAATGTTTACTTAATTAGTTTTAGGTGTTTATAATGAATAAT
CTGAAAGCAACGAAACCAGAGTGGCCATAACTCCATCTGCTGTTAAACCTTTACTGAAGT
ACTTAAAATCAATTTTTTTTTAATTCTAATTAATTTTTATTTCTAGAAATGGAGTTCATG
TTTGGATTGAGAAAGATTCTGGAAAGTCAAGTGGATTTTCTGATGAATAGTATTACAAAG
CTGGTGCAAAAATAGCAACAGCAAATGAAATTTTCTAAAATGCAAATATTTTAGTTTTTA
TCTCTTAATTGAAAGATAAGTAAATTAACTAAATTGGTAAGGCTGTTGAGTTGCTAGTTG
CTCCTCTTGGAAAAGAAAAAAAATAAGTTGTTTCTAAGCTAGCTAAAAACGAAAAACTTA
CTGTTGTTGATTTGAGTGATATTTCTCCTGAAGTTATACGTGCTTAAAAGCTAAGTACAT
CAGCTAATTAAGAAACCCTTTCATGTTACCGTTCAGTTTTTGAAGGTTTTTATCACTTAA
ACAAAATTGCTCGCCCAGTTTATAATAGTACTGGAAGATCACCTGGTGCTCATGTCCTAG
TTATAGGTGCTGACCATTTAGGCTTAACAGTAGCTAGCATTGCTAAATAGTATGGTTCAA
TCGTAAGGGTTTATGATAGAAGAGATGGATTGAAGCATTTAATTAAAAAAAGTGGTTTTA
TTCCAGTTGAGTTTGTGTAAATAATTTTTTTAATAAAGAAATATTTCTTTAAAAAAATAT
TTTTTTTAGATATGAAATAGTAAATAATAGCCCAAATCATGTTGAAGAAGTTTAAAAGAA
TGCTCTTAAAGAAGTTCTCAAAACCACAGATCTTGTGATTACAGCTTGTAAATAATATAA
TAAAATTTTCCATGAGATTAAATGTTAATTCGTTAATAAAATTAGCTTTCAAGGATGATG
GATCTGCTACCAAAGTCTTAAATGAGGAATTATGCAGTTTGTTAAGAAGAGGGTCTGTTA
TTGTAGACTTAGCAGCTGAAAAGGGGGGCAATACTTCTTTAACTTAGTTAGATAAAGTTA
ACCACGATGTAAATTTAGGTATTCATGTTATTGGTTACAGCTTTGGTAGCTATTGCTAGA
AACTCAATAGATAATCTAGTGAACTCCACTCTCTAAGCATCAACCACCTTTTCAATTAGA
TTTTCTTAAATAAAAATTTAGAACTTGGCTTGGTTGATTTACAAGATGAAACATTAAGAG
AAGTCTGTGTAAGAATTTTATTTTAACAAATATAATTGGTTTTTAATGATTATTACTAAT
TTATAAAGTACTTACACACCGGAAAAGATGTATCAGATAGATCATTTAAAAAGCACTAAC
ATGATCATGAGAAATTAGCTAACGAAAGTGAAATCCCTGATTAATCTGAGCAAAAATTAG
TTGAAAAATAAGATAAAGAAAGCGATAGAAAGAGTATTGACATTCAGCATTCAGAAGCTT
CTGTCCATTTAGATGGAAACAATGATAAAATTTCAGAGGAAAATAAGGAAAAAACATTTG
GAGAAAAGTTCAAAAATACTCTTAAGAAAACCGGAGAATATTATGAAAATTCCAAAGAGT
ATGTTCTTAACTTTGTTAGCGACTAATTCAGTGAAAAAAGAGAAGAAGAAATCAACAAGT
AATCAAAAAATTATTTAATTTTAAAAATATTTATTTGTTTATTTTAATTGTTAGGAATCC
TGGTGTTTTTGCTACTTTATTTACTGTGTTTGTACTTATCTTCTGTCTTTTCTTGGGAGT
TTTAACTGACAGTGAATTCATTTTCCAATTAGGACTTTTCATTCTTGCTTTATTTGTTGG
TGATACTGTAATTAAATAAGTTGATCCTGGTTTGAATGGACCTTTGCTATTATTTTTGTA
AACATTGAGTGGAAGCATTGGAATAGCCTGCATGCTTATCTTCTCATAAGAAGATAATGT
TGCTTTCTTTTCAGCCTTTACAATAATTGCTACTGTTGGAAACATGCTAGCTATGGCTTG
TGTTGTAGGAGGCTTTGCACTAACAATCAGGGCTGTTACTAACTTTACTCCAAGAGAATA
CAGATAAATAGATAACTCTGAATGA