Identifiers and Description

Gene Model Identifier

TTHERM_00989430

Standard Name

IGR6 (Induced during Granule Regeneration )

Aliases

PreTt07833 | 185.m00054

Description

Induced during dense core granule (DCG) regeneration; function unknown; transcription induced following exocytosis; may be cargo protein of dense core secretory granules

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Biological Process

Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 40.1%

TetraMine Data

TTHERM_00989430

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Stentor CoeruleusSteCoe_39550
Tetrahymena borealisEI9_02928.19.995417076252815e-72hypothetical protein (137 aa)

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:12456006: Haddad A, Bowman GR, Turkewitz AP (2002) New class of cargo protein in Tetrahymena thermophila dense core secretory granules. Eukaryotic cell 1(4):583-93

Sequences

>TTHERM_00989430(coding)
ATGAGATAGTAAAAGGTTTTGTTAATCACTCTTGCTGTCTTTAGTATATTAGGTGGCATA
CTTTTTGGTGTTCAACACAAAGATTACAAATGGGGAGAGAGTTTTACCAAAAATTTAAAT
AAGAGAATTACGGCCTGGAAAGAGTGTGTGAAACAATATACTGTTGACTGCTCAGATAAT
ACTATTTCTACTATTGAAGAATGTCAAAAAGCAGAAAAAAATTACATTGATTGTTATTAA
AATGAACCAAGCTGCTAGAAATGGGATAATATAATCTCAAAAGCTAAAAGGTATGAAATT
CTAAGAGAAGAAATGTACGAATGTGCATAGATGTGCGAGAGCTTCGCTGAAAAAGACAGT
TTTTATTACAAAGATATTTTTTTAGTCAAATATTAATTTTGTACAGAATGA


>TTHERM_00989430(protein)
MRQQKVLLITLAVFSILGGILFGVQHKDYKWGESFTKNLNKRITAWKECVKQYTVDCSDN
TISTIEECQKAEKNYIDCYQNEPSCQKWDNIISKAKRYEILREEMYECAQMCESFAEKDS
FYYKDIFLVKYQFCTE


>TTHERM_00989430(gene)
ATGAGATAGTAAAAGGTTTTGTTAATCACTCTTGCTGTCTTTAGTATATTAGGTGGCATA
CTTTTTGGTGTTCAACACAAAGATTACAAATGGGGAGAGAGTTTTACCAAAAATTTAAAT
AAGAGAATTACGGCCTGGAAAGAGTGTGTGAAACAATATACTGTTGACTGCTCAGATAAT
ACTATTTCTACTATTGAAGAATGTCAAAAAGCAGAAAAAAATTACATTGATTGTTATTAA
AATGAACCAAGCTGCTAGAAATGGGATAATATAATCTCAAAAGCTAAAAGGTATGAAATT
CTAAGAGAAGAAATGTACGAATGTGCATAGATGTGCGAGAGCTTCGCTGAAAAAGACAGT
TTTTATTACAAAGATATTTTTTTAGTCAAATATTAATTTTGTACAGAATGA