Identifiers and Description

Gene Model Identifier

TTHERM_00503890

Standard Name

IGR5 (Induced during Granule Regeneration)

Aliases

PreTt10669 | 64.m00149 | 3723.m00017

Description

Induced during dense core granule (DCG) regeneration; function unknown; transcription induced following exocytosis; may be cargo protein of dense core secretory granules

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Biological Process

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00503890

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

No Data fetched for Homologs

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:12456006: Haddad A, Bowman GR, Turkewitz AP (2002) New class of cargo protein in Tetrahymena thermophila dense core secretory granules. Eukaryotic cell 1(4):583-93

Sequences

>TTHERM_00503890(coding)
ATGGTCACATTAACACCTATTGCACTAGCAAATTCAAAAACAAATTTCACTGGATTTAGC
ATCTCAGGATAGACCAACAAAAATGTTACTAATTGCCGTGTTCCTACAAAGCTTACCTTT
GTTACATCAAGCAAGGATACTACACCCTAGAGTATTAAAAGTACAAACACCACTGATTTT
AGCAATCTTTACGTTGTTGATGATGTTAGCGGTGCTAGCTATAAATTAATCAACTCAGTT
GTTAACAATTACACTGCTAATCTTAATTTATACGTCTATCATAATGATACTGGTGTAGAT
AACCGTGTCTAATAAATCTTAAAACTAATCAATACATCTGCTTCCTCATTAATGGCTACA
TTAGTATTTGGTTTATTCACATTGCTTTTTTGA


>TTHERM_00503890(protein)
MVTLTPIALANSKTNFTGFSISGQTNKNVTNCRVPTKLTFVTSSKDTTPQSIKSTNTTDF
SNLYVVDDVSGASYKLINSVVNNYTANLNLYVYHNDTGVDNRVQQILKLINTSASSLMAT
LVFGLFTLLF


>TTHERM_00503890(gene)
ATGGTCACATTAACACCTATTGCACTAGCAAATTCAAAAACAAATTTCACTGGATTTAGC
ATCTCAGGATAGACCAACAAAAATGTTACTAATTGCCGTGTTCCTACAAAGCTTACCTTT
GTTACATCAAGCAAGGATACTACACCCTAGAGTATTAAAAGTACAAACACCACTGATTTT
AGCAATCTTTACGTTGTTGATGATGTTAGCGGTGCTAGCTATAAATTAATCAACTCAGTT
GTTAACAATTACACTGCTAATCTTAATTTATACGTCTATCATAATGATACTGGTGTAGAT
AACCGTGTCTAATAAATCTTAAAACTAATCAATACATCTGCTTCCTCATTAATGGCTACA
TTAGTATTTGGTTTATTCACATTGCTTTTTTGA