Identifiers and Description

Gene Model Identifier

TTHERM_00040340

Standard Name

IGR4 (Induced during Granule Regeneration)

Aliases

PreTt14570 | 2.m02134 | 3825.m02935

Description

Induced during dense core granule (DCG) regeneration; function unknown; transcription induced following exocytosis; may be cargo protein of dense core secretory granules; sequence similarity to IGR3

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Biological Process

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 13.9%

TetraMine Data

TTHERM_00040340

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_01070.14.999878681532552e-93p25-alpha family protein (145
aa)
OxytrichaContig17225.0.g433.001003044337619e-17p25-alpha

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:12456006: Haddad A, Bowman GR, Turkewitz AP (2002) New class of cargo protein in Tetrahymena thermophila dense core secretory granules. Eukaryotic cell 1(4):583-93

Sequences

>TTHERM_00040340(coding)
ATGTCTTTGTTATCTGCTTTTAAGAAATTCACTAATGACCGTTCTACCATGGAAGTTAAG
ATCTTCATTGGAGCTCTTACTGATAGTGGTGTCTTTAATGGAAGAGTCAATCCTAGCCAA
GCTGAATACATTTTCGATAAGGTTAAGAACAGTGCTAACTTGAGAGGTATTAACTACTAA
CAATTTGAAACCTGTTTATCCTAAATAGCTGCTCAAGGTGGTATGACTCGTTAACAAATT
GAAGGTATGTTGATTGAATAAAGCAAGAAGCTTGGTGCTAAGGAGGGTGATCCCTCCAGA
TTCTTCTATGACAAGAGCTCTTACACTGGTGTTCATACAAAGGGAGGTCCTTCTACTATT
GATAACAACGGTTATTCCCATCTTTCTTAACTCTGTGACAGAAGTGGTGCTAATGTTAGA
GGAGTTAACAAGTGA


>TTHERM_00040340(protein)
MSLLSAFKKFTNDRSTMEVKIFIGALTDSGVFNGRVNPSQAEYIFDKVKNSANLRGINYQ
QFETCLSQIAAQGGMTRQQIEGMLIEQSKKLGAKEGDPSRFFYDKSSYTGVHTKGGPSTI
DNNGYSHLSQLCDRSGANVRGVNK


>TTHERM_00040340(gene)
AACAATCAAAATAAAAAATAACCAAAACTAATAAAAAAACATAAATAAAAATCCCTATAT
TCTAAAATGTCTTTGTTATCTGCTTTTAAGAAATTCACTAATGACCGTTCTACCATGGAA
GTTAAGATCTTCATTGGAGCTCTTACTGATAGTGGTGTCTTTAATGGAAGAGTCAATCCT
AGCCAAGCTGAATACATTTTCGATAAGGTTAAGAACAGTGCTAACTTGAGAGGTATTAAC
TACTAACAATTTGAAACCTGTTTATCCTAAATAGCTGCTCAAGGTGGTATGACTCGTTAA
CAAATTGAAGGTATGTTGATTGAATAAAGCAAGAAGCTTGGTGCTAAGGAGGGTGATCCC
TCCAGATTCTTCTATGACAAGAGCTCTTACACTGGTGTTCATACAAAGGGAGGTCCTTCT
ACTATTGATAACAACGGTTATTCCCATCTTTCTTAACTCTGTGACAGAAGTGGTGCTAAT
GTTAGAGGAGTTAACAAGTGA