Identifiers and Description

Gene Model Identifier

TTHERM_00694350

Standard Name

IGR3 (Induced during Granule Regeneration)

Aliases

PreTt02919 | 107.m00099 | 3753.m00391

Description

Induced during dense core granule (DCG) regeneration; function unknown; transcription induced following exocytosis; may be cargo protein of dense core secretory granules; sequence similarity to IGR4 and p25 bovine brain protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Biological Process

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.2%

TetraMine Data

TTHERM_00694350

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_18416.13.999413844471248e-84p25-alpha family protein (150
aa)
OxytrichaContig17225.0.g433.999244945363787e-60p25-alpha

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:12456006: Haddad A, Bowman GR, Turkewitz AP (2002) New class of cargo protein in Tetrahymena thermophila dense core secretory granules. Eukaryotic cell 1(4):583-93
  2. Ref:17821280: Harrison JA, Fowler EH (1945) AN ANTIGEN-ANTIBODY REACTION WITH TETRAHYMENA WHICH RESULTS IN DYSTOMY. Science (New York, N.Y.) 102(2638):65-6

Sequences

>TTHERM_00694350(coding)
ATGCAAGCAAGCTTAGAAGGTGTTTTCAAGAAATTCACTGCCAACAAGGCTGATATGGAT
GGTAAGACTTTTGCCAAGTTCGCCAAGGATTGTGGTTTACTTGACAAGAAGCTCACTGCT
ACTGATATCGATCTTATCTTCGCTAAGGTTAAGACCTCTTCAGCTGTTAGAACTATTACT
TTTGCTCAATTCGAAAAGGGTCTTGATCAAATGGCTACCAAGAAGGGTATCTCCTTGGAT
GCACTCAAGGAAAAGGTTACCTCTGCTGGTGGTCCCACTTTCACTGGTACCAAGGCTGAT
GCCGTCAAGTTCCATGATGACAAGAGTCTTTACACTGGTGTCTATGCCAACGGTGGTCCC
TCTACAGTTGACATTGGAAACGGAAAGATTTCTGATATCTCCTAACTTTGTGACAGAACT
GGTGCTGACGTTAGAGGTGTCAAGAAATGA


>TTHERM_00694350(protein)
MQASLEGVFKKFTANKADMDGKTFAKFAKDCGLLDKKLTATDIDLIFAKVKTSSAVRTIT
FAQFEKGLDQMATKKGISLDALKEKVTSAGGPTFTGTKADAVKFHDDKSLYTGVYANGGP
STVDIGNGKISDISQLCDRTGADVRGVKK


>TTHERM_00694350(gene)
ATGCAAGCAAGCTTAGAAGGTGTTTTCAAGAAATTCACTGCCAACAAGGCTGATATGGAT
GGTAAGACTTTTGCCAAGTTCGCCAAGGATTGTGGTTTACTTGACAAGAAGCTCACTGCT
ACTGATATCGATCTTATCTTCGCTAAGGTTAAGACCTCTTCAGCTGTTAGAACTATTACT
TTTGCTCAATTCGAAAAGGGTCTTGATCAAATGGCTACCAAGAAGGGTATCTCCTTGGAT
GCACTCAAGGAAAAGGTTACCTCTGCTGGTGGTCCCACTTTCACTGGTACCAAGGCTGAT
GCCGTCAAGTTCCATGATGACAAGAGTCTTTACACTGGTGTCTATGCCAACGGTGGTCCC
TCTACAGTTGACATTGGAAACGGAAAGATTTCTGATATCTCCTAACTTTGTGACAGAACT
GGTGCTGACGTTAGAGGTGTCAAGAAATGA