Identifiers and Description

Gene Model Identifier

TTHERM_00225870

Standard Name

IGR2 (Induced during Granule Regeneration )

Aliases

PreTt12497 | 19.m00289

Description

XYPPX repeat family protein; Induced during dense core granule (DCG) regeneration; function unknown; transcription induced following exocytosis; may be cargo protein of dense core secretory granules

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Biological Process

Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00225870

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_05526.13.000074895537278e-78XYPpx repeat family protein (2
53 aa)
OxytrichaContig1218.0.g97.998167219297731e-26C2 domain
Stentor CoeruleusSteCoe_112550.000000000000004658886145103398
DictyBaseDDB_G02723560.000008000552149328928DDB_G0272356 on chromosome: 2
position 1290469 to 1292935

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:12456006: Haddad A, Bowman GR, Turkewitz AP (2002) New class of cargo protein in Tetrahymena thermophila dense core secretory granules. Eukaryotic cell 1(4):583-93

Sequences

>TTHERM_00225870(coding)
ATGGTAAAAGGAACTTTGATTGTCAGACCTAAGTCTGCTGTCTTGACTCATGATACTGAA
CTTTTTGGAAAAATGGATCCTTTTGTTATTATCACTATTGGTAGTTAAAAGAAGACCTCA
GCTGTAGCAAAAGATGCAGGAAAAACCCCTGCTTGGTGTGATTAATTTAACTTTTAGATA
TTAAGCGAAGATATGATGACATTCTCAATCTTTGACCACGATACCATGTCTAAGAACGAT
TTTATTGCTGAAGGCGGTTTCGCTCTTGCAAATGTACTTAAGGGAGGTAAGAGAACTGAA
ACTATTAATTGTATGAGAAAAGGAAAACCTGCTGGTAATTTAGTCTGTGAATTTGAATTT
TTACCTGATTAACAAAATGTTGCTTATGTTGTTCAATAACCTGTTGCTTATGGATAACCT
GGCTTTTAACCTGTTATGTAATAAGGATATCCCTAATACCCTGCTCAATAACCTTATCCA
GGTTAATAACCCTATCCTGTATAATAACCTTATCCTCCCTAATAGGCCTATCCTCCTCAA
GCTGGATACCCCTAATACCCTGCTTAAGGATATCCTCCTCAATAAGGCTATCCTCCTTAG
TAAGGATATCCTCCTTAACAAGGATACCCACCTTAACAAGGATACCCACCTCAATAAGGT
TACCCACCATAATAAGGTTACCCACCTCAACAAGGCTACCCACAATACCCTCCTAACCCT
TACCAATGA


>TTHERM_00225870(protein)
MVKGTLIVRPKSAVLTHDTELFGKMDPFVIITIGSQKKTSAVAKDAGKTPAWCDQFNFQI
LSEDMMTFSIFDHDTMSKNDFIAEGGFALANVLKGGKRTETINCMRKGKPAGNLVCEFEF
LPDQQNVAYVVQQPVAYGQPGFQPVMQQGYPQYPAQQPYPGQQPYPVQQPYPPQQAYPPQ
AGYPQYPAQGYPPQQGYPPQQGYPPQQGYPPQQGYPPQQGYPPQQGYPPQQGYPQYPPNP
YQ


>TTHERM_00225870(gene)
ATGGTAAAAGGAACTTTGATTGTCAGACCTAAGTCTGCTGTCTTGACTCATGATACTGAA
CTTTTTGGAAAAATGGTAATGAATCTATTTATTATAAAAATTTTAAATCTATACAGACAT
TTGATTGCTTGGTTATGTGTTTATTCAACAATTATTTTGAAAATGTTATTAGGATCCTTT
TGTTATTATCACTATTGGTAGTTAAAAGAAGACCTCAGCTGTAGCAAAAGATGCAGGAAA
AACCCCTGCTTGGTGTGATTAATTTAACTTTTAGATATTAAGCGAAGATATGATGACATT
CTCAATCTTTGACCACGATACCATGTCTAAGAACGATTTTATTGGTAAAATAAGATATTA
TTTATTGTGGATAGTAAATTAAACTATTGCTTTTATATGAAAATAGCTGAAGGCGGTTTC
GCTCTTGCAAATGTACTTAAGGGAGGTAAGAGAACTGAAACTATTAATTGTATGAGAAAA
GGAAAACCTGCTGGTAATTTAGTCTGTGAATTTGAATTTTTACCTGATTAACAAAATGTT
GCTTATGTTGTTCAATAACCTGTTGCTTATGGATAACCTGGCTTTTAACCTGTTATGTAA
TAAGGATATCCCTAATACCCTGCTCAATAACCTTATCCAGGTTAATAACCCTATCCTGTA
TAATAACCTTATCCTCCCTAATAGGCCTATCCTCCTCAAGCTGGATACCCCTAATACCCT
GCTTAAGGATATCCTCCTCAATAAGGCTATCCTCCTTAGTAAGGATATCCTCCTTAACAA
GGATACCCACCTTAACAAGGATACCCACCTCAATAAGGTTACCCACCATAATAAGGTTAC
CCACCTCAACAAGGCTACCCACAATACCCTCCTAACCCTTACCAATGA