Identifiers and Description

Gene Model Identifier

TTHERM_00558350

Standard Name

IGR1 (Induced during Granule Regeneration)

Aliases

PreTt07932 | 73.m00176 | 3735.m00070

Description

Dense core granule (DCG) protein; induced during DCG regeneration, function unknown; non-architectural cargo protein that localizes to and is secreted from DCGs during regulated exocytosis; not required for DCG lattice assembly

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Biological Process

Domains

  • ( PF07601 ) Protein of unknown function (DUF1562)

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00558350

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Stentor CoeruleusSteCoe_103210
Tetrahymena borealisEI9_17147.12.000808864924972e-124hypothetical protein (311 aa)

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:16014006: Bowman GR, Smith DG, Michael Siu KW, Pearlman RE, Turkewitz AP (2005) Genomic and proteomic evidence for a second family of dense core granule cargo proteins in Tetrahymena thermophila. The Journal of eukaryotic microbiology 52(4):291-7
  2. Ref:12456006: Haddad A, Bowman GR, Turkewitz AP (2002) New class of cargo protein in Tetrahymena thermophila dense core secretory granules. Eukaryotic cell 1(4):583-93
  3. Ref:11779800: Bowman GR, Turkewitz AP (2001) Analysis of a mutant exhibiting conditional sorting to dense core secretory granules in Tetrahymena thermophila. Genetics 159(4):1605-16

Sequences

>TTHERM_00558350(coding)
ATGAGAAAGATCATTCTTTTGTTAGCTATCATTAGTTTGGCACTCTGCTAAGAACTTATA
GTTGAAAAAGTAGCAGGATAATACAACTCAGGTTAAAAGTTCGCAAAATCCTGGTAAAAT
TCATAATGGAACGATTATCAAGATTTCGCTATTTATGGATGGTTTAAGATTGACTCTTCA
TACTAAATTGCTGAGTGGTCAACTGGTTTCCACTTTACTTCAAATTAGGACAAAGATTGG
ACTAACGCCTCTGCTCCTGGTGATAGAGTATTGGCATTCTGGGTTATTGGAAATACTCTC
CACAATCCTACTTACTCTTTAGCAAGAGGTAATACTAATTATTACGAAAATCTTTCCTTC
GCTGCTGGAGATACTAATAAATGGGCTTTTATTTATGTTACACATGGTTCTAGCTAATAA
GCATAATACGTCTATTACTTACTTCCTTCCTCTGGTGTTGTAACCAAGAAAATAGCTTCA
ATCACTCATAAAACTTCCACCTTCTATCAAATCAATGTTGGTTAATCATTCAGCTTCAAA
TATTTCCCTGGTTCTTTTTGGAGACTCTCACTTATTGCTGGACCTAATGCTTACAGAGAA
AGTGGTTTTGAATAGTTCTAAAACATATAACCTGACGTTGTTCCTAGCTGTCCTATTCTT
TTCACTGGATGTAACTATAGTGGTAAGGGTGATTCTTTATGCTAAAGCTCTCCTTCTTAT
AACGTTACTGCTGTTCACTCAATCTACCTCCCTGCTAACTTCACTGCTACTTTACATGAT
CAAGCTAATTACGCAGGAAAGAAGATCGTTTATTCCCAAAGTATTGAATGTATTACCTAA
TTAAATTGGGCTTACTTACTCTCTACTCATGCCATTACTATTGAGGATGAAACTAAAACT
GTTCTCAGAAGAAACAACAGAAGAAATTGA


>TTHERM_00558350(protein)
MRKIILLLAIISLALCQELIVEKVAGQYNSGQKFAKSWQNSQWNDYQDFAIYGWFKIDSS
YQIAEWSTGFHFTSNQDKDWTNASAPGDRVLAFWVIGNTLHNPTYSLARGNTNYYENLSF
AAGDTNKWAFIYVTHGSSQQAQYVYYLLPSSGVVTKKIASITHKTSTFYQINVGQSFSFK
YFPGSFWRLSLIAGPNAYRESGFEQFQNIQPDVVPSCPILFTGCNYSGKGDSLCQSSPSY
NVTAVHSIYLPANFTATLHDQANYAGKKIVYSQSIECITQLNWAYLLSTHAITIEDETKT
VLRRNNRRN


>TTHERM_00558350(gene)
ATGAGAAAGATCATTCTTTTGTTAGCTATCATTAGTTTGGCACTCTGCTAAGAACTTATA
GTTGAAAAAGTAGCAGGATAATACAACTCAGGTTAAAAGTTCGCAAAATCCTGGTAAAAT
TCATAATGGAACGATTATCAAGATTTCGCTATTTATGGATGGTTTAAGATTGACTCTTCA
TACTAAATTGCTGAGTGGTCAACTGGTTTCCACTTTACTTCAAATTAGGACAAAGATTGG
ACTAACGCCTCTGCTCCTGGTGATAGAGTATTGGCATTCTGGGTTATTGGAAATACTCTC
CACAATCCTACTTACTCTTTAGCAAGAGGTAATACTAATTATTACGAAAATCTTTCCTTC
GCTGCTGGAGATACTAATAAATGGGCTTTTATTTATGTTACACATGGTTCTAGCTAATAA
GCATAATACGTCTATTACTTACTTCCTTCCTCTGGTGTTGTAACCAAGAAAATAGCTTCA
ATCACTCATAAAACTTCCACCTTCTATCAAATCAATGTTGGTTAATCATTCAGCTTCAAA
TATTTCCCTGGTTCTTTTTGGAGACTCTCACTTATTGCTGGACCTAATGCTTACAGAGAA
AGTGGTTTTGAATAGTTCTAAAACATATAACCTGACGTTGTTCCTAGCTGTCCTATTCTT
TTCACTGGATGTAACTATAGTGGTAAGGGTGATTCTTTATGCTAAAGCTCTCCTTCTTAT
AACGTTACTGCTGTTCACTCAATCTACCTCCCTGCTAACTTCACTGCTACTTTACATGAT
CAAGCTAATTACGCAGGAAAGAAGATCGTTTATTCCCAAAGTATTGAATGTATTACCTAA
TTAAATTGGGCTTACTTACTCTCTACTCATGCCATTACTATTGAGGATGAAACTAAAACT
GTTCTCAGAAGAAACAACAGAAGAAATTGA