Identifiers and Description

Gene Model Identifier

TTHERM_00648910

Standard Name

IFT52 (IntraFlagellar Transport 52 homolog)

Aliases

PreTt09205 | 94.m00123 | 3677.m00031

Description

Intraflagellar transport protein; essential for ciliary assembly, maintenance, and rotokinesis

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Biological Process

Domains

  • ( PF01857 ) Retinoblastoma-associated protein B domain

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.4%

TetraMine Data

TTHERM_00648910

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_17844.19.997093137033517e-262IFT52/Intraflagellar transport
er 52 (435 aa)
OxytrichaContig15520.0.g512.0005106264580874e-134ABC-type uncharacterized trans
port system
WormBaseWBGene000038862.9990539278805726e-74locus:osm-6 status:Confirmed
UniProt:G5EDF6 protein_id
:CAB61026.2
Stentor CoeruleusSteCoe_198833.1743585474772134e-60

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:12925756: Brown JM, Fine NA, Pandiyan G, Thazhath R, Gaertig J (2003) Hypoxia regulates assembly of cilia in suppressors of Tetrahymena lacking an intraflagellar transport subunit gene. Molecular biology of the cell 14(8):3192-207

Sequences

>TTHERM_00648910(coding)
ATGAGTGGAGAATAGAAAATTATTGTCTTCAACGCTTCAAAGAAGGAGGCTGGTAACCCT
AGTACAAATATTAAAAAGATTATCAAGAAATATAAAGAAACATATAAGTGCGGCAGAAAT
AAAGAAGATATCACATATGATAGACTAAAGATGGCTTCTTTGGTCATATTTTTTTGCCCC
AAAGAAATGTTTACCAAGGAGGAATTCGATGCCCTCAAATAATACTTAGAAAGTGGTGGT
CGTGTCTTAGTTTTGAGCTCTGAAGGTGGTGGTCATAAGAATCGCACAAATATAAATTTC
TTCTTGGAATAATATGGTATCAGTATCAATAACGATTGTGTCGTTAGAACTGCATTTTAT
AAATACTTCCATCCTAAGGAGACTTATGTTCATTCTGGTATTTTAAATGAAGAAGTAACA
AGAGTAGCAAATGGTTTACCTAAAGAAACAAAGAGACCCCAAAATACATTCTTGTAAAAC
GTTATTGGAAAGGATGATGAAGAAGATGAATATTAAAAGGAACAATCTAGAGTTGGTTTA
GATTTTGTTTATGCCTTTGGTGCTACCTTGACTGTTTAATAACCTGCACACGCTATTTTA
GGTTCTGGTCCTCTTTCTTACCCTTCTAATAGACCAGTTTCTGCTATCGTCTAAACTAAA
AATAATGGTAGACTTGCAGTTATTGGTTCATTCGAAATGTTTACAGATGAATATTTTGAC
AATGAAGATAACTCCAAGATTTTTGATTTCTTTATAAAATATTTGCTCACAAATGAGTGC
GAATTTGAATTTAGTCCTAAAGAACCTGATGTTGAATACTTCAAGGTTCCTGATATTGCT
GAATTAGCTGATAACCTCAAGAGTTGCTTACAAGAAAGTGACCCATTACCATTTGATAGC
AAGCAATTATTTATGACAGACTTGTTTAAGTATGATGTAGACTTAGTTCCAGAAGCTGTA
AAATTGTATGAAACTCTTGGAGTAAAGCACGATCCTCTTGCTCTTATAGTTCCTTAATTC
GAAACTCCACTCCTTGGACTTGTTTCAGCTGTTTTCCCACCTATTTTAAAAGAATTAGCT
CCTCCAAGTTTAGAATTGTTTGATTTAGATGATGAATTTGCTTCAGAAAAAGTAAGACTG
GCCTAACTCACAAATAAATGCAACAACAACGATTTAGATTATTACATTAAAGAATCAGGT
GATATCTTGGGTGTAACAGATAAAGTTAAGAACAAACATGATGCCAAAGCTATTTTAAGA
TATGTTTTAGAAGAATTAATAAATTTCAAGAAGCTCAATAACTGA


>TTHERM_00648910(protein)
MSGEQKIIVFNASKKEAGNPSTNIKKIIKKYKETYKCGRNKEDITYDRLKMASLVIFFCP
KEMFTKEEFDALKQYLESGGRVLVLSSEGGGHKNRTNINFFLEQYGISINNDCVVRTAFY
KYFHPKETYVHSGILNEEVTRVANGLPKETKRPQNTFLQNVIGKDDEEDEYQKEQSRVGL
DFVYAFGATLTVQQPAHAILGSGPLSYPSNRPVSAIVQTKNNGRLAVIGSFEMFTDEYFD
NEDNSKIFDFFIKYLLTNECEFEFSPKEPDVEYFKVPDIAELADNLKSCLQESDPLPFDS
KQLFMTDLFKYDVDLVPEAVKLYETLGVKHDPLALIVPQFETPLLGLVSAVFPPILKELA
PPSLELFDLDDEFASEKVRLAQLTNKCNNNDLDYYIKESGDILGVTDKVKNKHDAKAILR
YVLEELINFKKLNN


>TTHERM_00648910(gene)
ATGAGTGGAGAATAGAAAATTGTATTCAATTTTTCATAGTTTTAGCAGCTAGCTTTTATT
TTGATAGAATTCATGTCACTCAAATCGATCTATCATTTTAAAGATTTTTTTCCTAATATA
ATAAATAGATTGTCTTCAACGCTTCAAAGAAGGAGGCTGGTAACCCTAGTACAAATATTA
AAAAGATTATCAAGAAATATAAAGAAACATATAAGGTAATAGAGTTTATATTATTATCAT
TAATCAGTTTGACTTAGCAGATTTTGTCTTAAAGGGCTCTATTTCAAAAAATCAATCTAC
ATGCAAACCAATCTCTTACTTACGAAGGAGAAATATTTCAAAATATTTAACAAGAACAGT
TTTAAAAATAAATTGATTTTAACCAAAACAATTAAAAGAATTTATAATAAAATCTATATG
CGATTGATAATATAAGCCCTTAATAAGGTTTCTTATCTTAAGTTTGTTATTTTATCATAA
AGTGCGGCAGAAATAAAGAAGATATCACATATGATAGACTAAAGATGGCTTCTTTGGTCA
TATTTTTTTGCCCCAAAGAAATGTTTACCAAGGAGGAATTCGATGCCCTCAAATAATACT
TAGAAAGTGGTGGTCGTGTCTTAGTTTTGAGCTCTGAAGGTGGTGGTCATAAGTAATTAA
CATAAAAACAATTCTAAGAATGCCTTTCTATTTTTCTATATAATTTATTTTAAAATGCCT
CATTAAAATTTCAAAATTAATTCAAATCTTAGTTTAGAGATTAGCAAATATAAAAAGGCG
AGGATGAATGAATAAATGAAAATTTATAAATAGATTGATAAAACATGTTAATTTCAAAAA
TTAATTTATTAATGAAGCAAATAATAACTAAAGAAAGATGTTTAATTTTAAAATTTTATG
CAAACATACCAAAAAAACTCAGATAAAAACAAAATTTTAATAAAATAAGGAGAATATTTT
AAGCAACGCCTCGTACATTTATTTATCTTTAAGTTAATTCTAAAACTTATTATTTTATTT
AGAGAAAATAAATTCAAATTCTTAACTAAATTTAAACAAATTAAGATGAAAAAATGAATT
TTTTTGAAATGAAATTTGGATTGTATTAAAAAAATTGCATTCATTTTGCTAAAATATTTT
AATAAAAATTGAAATAAGCTTAGCAGATTCAAATAAATTTGGATAATGTCATAAAATAGT
TTGAATTTTACTAAATAATTTATCGAAATTCTTTGAAAACAATTTCATTATCAAGGAATC
TGAAAATTTATTTTTAAAAATATTTTAATATAAATTTAATAAAGCTTAACTGATTCAAAT
AGATTTGGAAAGTGTTATAAAAAAGTTTGAATTTCACTAAATAATTTGTCAAAGTTCTTT
GAGAACAATTTCATTATTTTTTTTCCAAGGAATCTGAAAATTAAAAAAAATATTTTAATA
TTGAAATAAGATTAACAGATTTTAATAAATTTGGAAAGTGTTATAAAAAAGTTTGAATTT
CACTAAATTATTTATCGAAATTATTTGATAACAATTTCATTATTTTTTTACAAATGAGGG
ATTTTAAAATAAGTTTGATATGTCTTAAAAAAATAATTTAAATTTTAAATAAAACTAATT
TGTAATTTATTAGAGTAAAAAAATATTTAATAAAATAGGAATCGCACAAATATAAATTTC
TTCTTGGAATAATATGGTATCAGTATCAATAACGATTGTGTCGTTAGAACTGCATTTTAT
AAATACTTCCATCCTAAGGAGACTTATGTTCATTCTGGTATTTTAAATGAAGAAGTAACA
AGAGTAGCAAATGGTTTACCTAAAGAAACAAAGAGACCCCAAAATACATTCTTGTAAAAC
GTTATTGGAAAGGATGATGAAGAAGATGAATATTAAAAGGAACAATCTAGAGTTGGTTTA
GATTTTGTTTATGCCTTTGGTGCTACCTTGACTGTTTAATAACCTGCACACGCTATTTTA
GGTTCTGGTCCTCTTTCTTACCCTTCTAATAGACCAGTTTCTGCTATCGTCTAAACTAAA
AATAATGGTAGACTTGCAGTTATTGGTTCATTCGAAATGTTTACAGATGAATATTTTGAC
AATGAAGATAACTCCAAGATTTTTGATTTCTTTATAAAATATTTGCTCACAAATGAGTGC
GAATTTGAATTTAGTCCTAAAGAACCTGATGTTGAATACTTCAAGGTTCCTGATATTGCT
GAATTAGCTGATAACCTCAAGAGTTGCTTACAAGTAAATTAATGAATATTATAACAGTTA
TTTAAATTTATGCATAATTAATTTTATATAGGAAAGTGACCCATTACCATTTGATAGCAA
GCAATTATTTATGACAGACTTGTTTAAGTATGATGTAGACTTAGTTCCAGAAGCTGTAAA
ATTGTATGAAACTCTTGGAGTAAAGCACGATCCTCTTGCTCTTATAGTTCCTTAATTCGA
AACTCCACTCCTTGGACTTGTTTCAGCTGTTTTCCCACCTATTTTAAAAGAATTAGCTCC
TCCAAGTTTAGAATTGTTTGATTTAGATGATGAATTTGCTTCAGAAAAGTAATTAATTTT
TATAAAAGAAGATTTTAAATATTTTCAAATAAATTCTAACAATATTTTTTTAAAAATTAA
CAGAGTAAGACTGGCCTAACTCACAAATAAATGCAACAACAACGATTTAGATTATTACAT
TAAAGAATCAGGTGATATCTTGGGTGTAACAGATAAAGTTAAGAACAAACATGATGCCAA
AGCTATTTTAAGATATGTTTTAGAAGAATTAGTAATTTAAAATTTTGATAAAAACAATAT
TTTAAGCATATTTTAATATTTAATAATAACAGATAAATTTCAAGAAGCTCAATAACTGA