Identifiers and Description

Gene Model Identifier

TTHERM_00089240

Standard Name

IFT172 (IntraFlagellar Transport 172)

Aliases

PreTt16475 | 6.m00549 | 3836.m02141 | EF495115 | IFT172

Description

N-terminal WD domain (WDD) and C-terminal repeat domain (RPD) containing protein; involved in anterograde and retrograde transport during ciliary assembly; essential for ciliary assembly

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Biological Process

Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 12.1%

TetraMine Data

TTHERM_00089240

WebApollo

Fullscreen View

Tetrahymena Stock Center

  • ( SD01793 ) Micronucleus: Neo3 into coding of IFT172
  • ( SD01794 ) Micronucleus: Neo3 into coding of IFT172
  • ( SD01795 ) Micronucleus: Neo3 into coding of IFT172

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Stentor CoeruleusSteCoe_329780
WormBaseWBGene000038839.997093137033517e-262locus:osm-1 Intraflagellar t
ransport protein osm-1 statu
s:Confirmed UniProt:Q22830
protein_id:CCD72791.1
Tetrahymena borealisEI9_02512.19.997093137033517e-262IF.272/intraflagellar transpor
t particle protein 172 (1719 a
a)
OxytrichaContig20157.0.g309.997093137033517e-262Region in Clathrin and VPS

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:18199688: Tsao CC, Gorovsky MA (2008) Different effects of Tetrahymena IFT172 domains on anterograde and retrograde intraflagellar transport. Molecular biology of the cell 19(4):1450-61
  2. Ref:18211962: Tsao CC, Gorovsky MA (2008) Tetrahymena IFT122A is not essential for cilia assembly but plays a role in returning IFT proteins from the ciliary tip to the cell body. Journal of cell science 121(Pt 4):428-36

Sequences

>TTHERM_00089240(coding)
ATGCATAAAAAAAAAATAAAGCCATTCAGAAACACAAACAATTACTAATTTCCAAAGAGA
GGATTCATTGTTTTAATCTTTTAGATTGAATAAATTTCAAATTTTTAAAAAAGAAAAAAA
ATAAAAAAATAAAATAAAAAAGAAATAATAAAGGTATTTGCTTTAATTTTATAAAGTAAA
GAAATGAAACTTGCTTATTTTGGAAATATCATTCCACCAGTTGATGGAATGCAAAAGATT
TCATCAGTAGCATGGTCTCCTAATTAGCATGGGCCAAAAAAACTCGCAGTTTGCACAGCT
GAAAGAGTAGTTCATTTGTTTGATGAGCAAGGATAGCGTAGAGATAAGTTTATGACAAAA
CCATCAGACAAGGGTTAAAAGTCATATGTTGTTAGAGCAGTAGCTTTTTCTCCAGATAGT
GAAAAGGTAGCAGTCGCATAATCAGATAATATAGTTTTTGTCTATAAGATTGGCAAGGAA
TGGGGTGAAAAAAAATCTATTTGTAATAAATTCCCAACTTCTTCCTCAGTAACATGTCTT
TGCTGGCCTCATGAACGTGCAGGAGAAGTTATTTTTGGTTTGGCTGAAGGTAAAGTCAAA
TCCGGTATCCTTCGTTCAAACAAATCATAAGTAATGTATTCAACTGATAGTTATGTTGTT
AGCTTAGCAGCATGTAAAGACGGAGAAAATTTTGTAAGCGGTCACTTAGATGGTACAATC
TACGCATTTGGAAAAAAAATTGTAGTTCATCATTCAATCCCATATGCTTTAGGCTGGGGA
GAACATGTTGTCGCTGCTGGTAATGATGGAAAGGTTTCTTTTTACGATGCTTATGGCAAT
CATATTTAACGTTTTGATTATACAAATGATGATAAAATAAGAGAATTCACTATAGCCGCA
TTCAACCCATCTGGCGACACAGTTGTTTTAGGCAACTTCAATAGATTTTATATCTATCAT
TACAACTCCAGAAGAAGTCTCTGGGAAGAAATTGGTGTTAAATAAATTGAAAATTATTAT
ACTGTTACAGCTCTTGCATGGAAAAACGATGGTTCTAAATTAGTAACTGGTTCTCTTTGC
GGAAGTGTTGATTGGTACAATGCCTCATTTAAAATGATTAATTATAAGGGAAAGTTTGAG
TTGAATTATGTGTCTCCTTCATAAATTGTAGTCAAAACATTATCATCTGGTAGAAAATCT
GTTGTTAGAAGTGCCTAAGGTGCTGAAATTACCAAAATCAACATTTTCTAGGACCGTTTT
GCAGTTGGTAATACTTATGATACTATCATAGTAGCTGATTTAGAAGTTGATAAATGCTCA
GAAATTCCATGGAGAAATGATGGTAAAGAAAAGTATGACTTTTCAAATCCAGGAGTCTGC
ATGGTTTTTAGCAGTGGAGAATTGACTTTGATCGAATATGGAAACAATGAACCTCTTGGT
AACTGCAGAACTGAGCACATGAAAACTAATTTAATTTCTGCTAGATTAAACTACCACAGT
GTGAAATAAACTAAAATGATTGCTTATCTCTTAGATTTGCAAACCATTTACATTTAAGAT
CTCATGAGTAACTCAAATATTGGTTAGATTCTTCATGATTCGAAAATTGATTTCTTAGAA
CTTAACACTCATGCTAATAAGCTCTTGTTTAGAGACAAGAGAAGATAACTCTACCTTTAT
AATATCAAAACTTAAACTAAAAATACTCTTCTCAGTTACTGTAGTTATGCTTAGTGGGTT
CCTGAATCAGATGTAGTTGTTGCTTAAAACAGATAAAACCTATGTGTTTGGTATTCAATT
GAAAATCCAGATAAAGTCACAATCTATAACATTAAGGGAGAAGTTGAGTCTATTGAAAGA
AATGGAGGTAAGACTGATGTGATGGTAAATGAAGGAAATAATGTAGTTCCTTACAGCTTA
GATGAATCTCTTATTAACTTTGGTTTTGCAATTGAATCAGGAGATCTTGAAAAAGCAGCT
ACAATTCTTGACCCATTAGAGATGAATGCTGACACAGAAGCTAACTGGAAAACATTATCT
AAGTTAGCTCTTGAAGAGTAAAATATTATAGTTGCTGAGCACTGTTATGCTTCTTTAGGT
GATATTTGCAAGGCTTCTTATTTAAGAAAGATTTCTAAGCTTGCCAGAGAAAGTGAAGAA
GGTATCAATTACTACAAGGCTCAAGCTAAGCTTGCCATCCTCGATAAACAATTCCACAGA
GCTGAAGCTATTTTATTAGATCATGAAGAGGTTGAAGAAGCTATGGAAATGTATTAGGAA
CTCCATAAATGGGATGAATCAATTAAGATTGCTGAAAAGAAAAACCATCCTTAGGTTAGA
GAACTCAAGGAAAATTATTACACTTGGCTTCTAAAGACAAAGTAGGAAGCTAAGGCTGCT
GAAGTTAAGGAAAATGAAAGAGATTTTAACAAGGCTGTCTAGCTCTACTTACAAGGTAAT
CTTCCAGCTAAAGCTGCTAATGTAGTGTTTACATATGATCACTCTTTCCCTTAGGACATT
CTCGAAAATATTGCTGTAGCTCTCAAAAACGCAGGAATGTATGAAAGAGCTGGTGAATTC
TATGAATAAATGGAATAATATCCTAAAGCTCTCTAAATGTACCGTGAAGGAAATTCTTAC
AAAAAAGCAATCGATCTTGCTAAAAGAGTTCAACCAAATTTAGTCCGTGAATTAGAAGAG
AGGTGTGGTGATTGGTTAGTTAGCTAAAAGTAAACTGAAAGTGCTGTTAATCATTATATT
GAAGCTGGATCTTTCTAAAAGGCCATTGAAGCTAGTATCAATTCAAGATAATGGAGCAAG
GCAATCTAACTTTTATAACATTAAAGTCCTGAAATGGCTCGTCCTTTTTATAGACAAATT
GCTAAGCATTATGCTGATGTTCGTCAATATGATTTTGGTGAGAAATATTATTTGAAGGCT
GGCTTAGCTGTTGAAGCTTTTGAAATGTATGCCAAGGCTTCAAAATGGGAGCATGCCTTA
CGTGTTGCTCGTGAAAATCTCCCTGAAACTGAAATTGTCTAATTATATGTTAAATAGGCT
ATCAAATTCTAGGAACAAAACCTCTATAAGGAAGCTGAAAAACTCTACTGCTAAGTAGAT
GAGTATGATCGTGCTATTGATATGTATTAAAGAAGTGAGTAGTATGAATCTATGCTTCGT
TTAGTAGCTAAATATAGACCTAAATAATTAAGAGATACTCATTTATAAATTGGTCAAAGA
TTATAGCGTGCTGGAAACTTGAAATAAGCAGAACATCACTATATTGAAGCTGGTGCTTGG
CATGCTGCTGTTGACATGTATCAATCTAATGGAAATTGGGAAGATGCTGTCAGATGCTGC
AAGCTTTATGGATCTGATAAGGAAACATGTGAACTTGCTAAATAATGGGCAGAAACTTTG
GGTCCTGATGCTGGTATGAAAATTCTTTTAAAATACAATTTAATCGATGCTGTCATTGAA
TATCTTTGTGATAGAAAGGAATTCGATGAAGCTTTTAGAATGGCTCAAAAGGCTATCCAT
AAAAAGCCTGATGTTCACCTCAAATATGCATTTGAACTTGAAGATAACAAAAGATATAAG
GAAGCTGAAGAACACTTTATTAAGGCAGGTAAACCTGAAGAAGCTATTAATATGTATGAG
CATTTGAGTGATTTCTAAGCTGCATTATAGGTAGCAAAAGTACACTAAAAATAGAGTATA
AGCATGATTCTTATGAATTAAGCTCGTACTTTCATTGAAAAAAGAGAATATAAGAAGGCT
GAAAACTGCTTTATCCAGGCTAAGAAACCAGAATTAGCAGTTAAAATGTACAAGGATATT
TAAAATTGGTAAGAAGCCTTCAGAGTAGCCAAAAAGGAAGCTCCTCATTTAGTTTCAGAA
CTTACTTCTTAACATTAATAAGTTGGTAGAGGAGGAGCTATGACTGGTGAAGACTATATC
TAAAATGCTAGAGTATCTGAAGATAGCAGAGATTACAACAAGGCAATAGATTCTTACCTC
AATGTTACTCCTGAAAATTGTGATGAAAATACAGTTGTAGCAGTCTGGAATAAAGCTATA
TAAATTGCCTAAACTTATGTTAAGGAAAGATTGCAAGAAGTTGTCTTAATTGTTGCAAAG
GGATTATAAAATTTAAATAAAGCTGATTAGGCTGCTGATATTTATGAAAACTTTGGATTC
TACTAAGAAGCTTCATAACTTTATCTTGAATTAAGAAATTATGCCAAAGCTAAATAATGT
GCCTAATAAGTCAATAATCCTAGTTTCTAGTAGAAGATGATAGCACGTATCTAATAACTT
CAAATGACTGAATAATAAAACACAGGAGATACTAGAGGTATGATTGAAGGTGGTCATGTT
GACTAAGCTATAGAAATGATGATTTAAAAAGGAGATTGGAGATAGGCATTAGACACAGCT
CAAAATCAGGGTGCAGAAATACTAGCCAAGATAATGAGACGCTATGTCAAATTTACTATG
GAAAGTGGTAAATTTGGTGAAACTATTGAAGCCTATGCTCACTACGGCATGCAGTTGATT
CCTGAAAACTTTAAGCATTACATTAACCTTTGCTTAGAAATATTTGTTGAGTGCGATCCT
AAAGAAATCAACAGCTTGCGTACTGCTTTATATAACTTTTACAAACTCTTATAAGGCTCT
AAAGTAGACTAGTCTCAAGAAGGAAGATAATTCTAAAGGTACTTAACCATAGCACACTTA
GCAAACCTAAAGAATGTTTATGAAAAGAAAAATATGAGTGCTCTTTATGCTAGAACTTCA
ATTTCAATGCTTAGATACGGAGATCTTATTCGTATGGATAAATTGTTCTATGATGCAGGT
GTTGCTTGCAAAAAATAAAACTGGCTCACATATGCATTCGTCATCTTAAATAGATACTTA
GATATCTTTGAAGTCATAGAAGATCCTAACAGTGCTGATACTGGAGATAACTAAGTCTTC
TTAAATACTGATATTCCATCTCCTTATTAAGTAGAACTCATTCCTGAAAAGAACCTAGTA
GACTCAAATCAAATTGAAGGAATACGTAATTGGATTTTGGAAGTTAGTTGCAATTCTAAA
ATAGAAAAGGACTTACCTATCCGTAGTTGTGAAAGCTGCAGAACTTAAATATATGAAGGA
TGCCAAACATGTCCTAAATGTAAAACTGAGGCTGAAGTTTGTATCCTAACAGGATAACCT
CTTTTAAAGGGAACATTCGTTAACTGTAGAAGTTGCGGAAAAGGAGGTCTCAAAGAATAT
TGGTCGATGTACTTATAAAACTTTGCAAACTGTCCTTGGTGCAATAATCCCCCAAATTGA


>TTHERM_00089240(protein)
MHKKKIKPFRNTNNYQFPKRGFIVLIFQIEQISNFQKRKKIKKQNKKEIIKVFALILQSK
EMKLAYFGNIIPPVDGMQKISSVAWSPNQHGPKKLAVCTAERVVHLFDEQGQRRDKFMTK
PSDKGQKSYVVRAVAFSPDSEKVAVAQSDNIVFVYKIGKEWGEKKSICNKFPTSSSVTCL
CWPHERAGEVIFGLAEGKVKSGILRSNKSQVMYSTDSYVVSLAACKDGENFVSGHLDGTI
YAFGKKIVVHHSIPYALGWGEHVVAAGNDGKVSFYDAYGNHIQRFDYTNDDKIREFTIAA
FNPSGDTVVLGNFNRFYIYHYNSRRSLWEEIGVKQIENYYTVTALAWKNDGSKLVTGSLC
GSVDWYNASFKMINYKGKFELNYVSPSQIVVKTLSSGRKSVVRSAQGAEITKINIFQDRF
AVGNTYDTIIVADLEVDKCSEIPWRNDGKEKYDFSNPGVCMVFSSGELTLIEYGNNEPLG
NCRTEHMKTNLISARLNYHSVKQTKMIAYLLDLQTIYIQDLMSNSNIGQILHDSKIDFLE
LNTHANKLLFRDKRRQLYLYNIKTQTKNTLLSYCSYAQWVPESDVVVAQNRQNLCVWYSI
ENPDKVTIYNIKGEVESIERNGGKTDVMVNEGNNVVPYSLDESLINFGFAIESGDLEKAA
TILDPLEMNADTEANWKTLSKLALEEQNIIVAEHCYASLGDICKASYLRKISKLARESEE
GINYYKAQAKLAILDKQFHRAEAILLDHEEVEEAMEMYQELHKWDESIKIAEKKNHPQVR
ELKENYYTWLLKTKQEAKAAEVKENERDFNKAVQLYLQGNLPAKAANVVFTYDHSFPQDI
LENIAVALKNAGMYERAGEFYEQMEQYPKALQMYREGNSYKKAIDLAKRVQPNLVRELEE
RCGDWLVSQKQTESAVNHYIEAGSFQKAIEASINSRQWSKAIQLLQHQSPEMARPFYRQI
AKHYADVRQYDFGEKYYLKAGLAVEAFEMYAKASKWEHALRVARENLPETEIVQLYVKQA
IKFQEQNLYKEAEKLYCQVDEYDRAIDMYQRSEQYESMLRLVAKYRPKQLRDTHLQIGQR
LQRAGNLKQAEHHYIEAGAWHAAVDMYQSNGNWEDAVRCCKLYGSDKETCELAKQWAETL
GPDAGMKILLKYNLIDAVIEYLCDRKEFDEAFRMAQKAIHKKPDVHLKYAFELEDNKRYK
EAEEHFIKAGKPEEAINMYEHLSDFQAALQVAKVHQKQSISMILMNQARTFIEKREYKKA
ENCFIQAKKPELAVKMYKDIQNWQEAFRVAKKEAPHLVSELTSQHQQVGRGGAMTGEDYI
QNARVSEDSRDYNKAIDSYLNVTPENCDENTVVAVWNKAIQIAQTYVKERLQEVVLIVAK
GLQNLNKADQAADIYENFGFYQEASQLYLELRNYAKAKQCAQQVNNPSFQQKMIARIQQL
QMTEQQNTGDTRGMIEGGHVDQAIEMMIQKGDWRQALDTAQNQGAEILAKIMRRYVKFTM
ESGKFGETIEAYAHYGMQLIPENFKHYINLCLEIFVECDPKEINSLRTALYNFYKLLQGS
KVDQSQEGRQFQRYLTIAHLANLKNVYEKKNMSALYARTSISMLRYGDLIRMDKLFYDAG
VACKKQNWLTYAFVILNRYLDIFEVIEDPNSADTGDNQVFLNTDIPSPYQVELIPEKNLV
DSNQIEGIRNWILEVSCNSKIEKDLPIRSCESCRTQIYEGCQTCPKCKTEAEVCILTGQP
LLKGTFVNCRSCGKGGLKEYWSMYLQNFANCPWCNNPPN


>TTHERM_00089240(gene)
ATGCATAAAAAAAAAATAAAGCCATTCAGAAACACAAACAATTACTAATTTCCAAAGAGA
GGATTCATTGTTTTAATCTTTTAGATTGAATAAATTTCAAATTTTTAAAAAAGAAAAAAA
ATAAAAAAATAAAATAAAAAAGAAATAATAAAGGTATTTGCTTTAATTTTATAAAGTAAA
GAAATGAAACTTGCTTATTTTGGAAATATCATTCCACCAGTTGATGGAATGCAAAAGATT
TCATCAGTAGCATGGTCTCCTAATTAGCATGGGCCAAAAAAACTCGCAGTTTGCACAGCT
GAAAGAGTAAGATTTAAAATATTTCATTTTTAAAACGATTTGTAAACAAAATTTCCATAC
TTTTTCCATAGGTGCTTTGTTATTTTTCTTTTTAAGTTAGGTTTCTACTTAATTTTCATA
TACAAAGAAAGCACTTAAAACTGCTTTATTCTTTTAACAATAGCAAATAATCTAAGCTAA
AAGGAATTCAAACCATTAAATAATTAGCGATTAAAAGATTTAAAACATGATTAATTTTAT
TATGAATGTTTAATTTATAGAATTTTTTTATAAATAAAGGTAGTTCATTTGTTTGATGAG
CAAGGATAGCGTAGAGATAAGTTTATGACAAAACCATCAGACAAGGTATTTATTTATTCA
CAAAAATAAAAAAAGGAATTCAATAATGACAATTAAAATAAATCCAAATGGATTTTTATT
AGTATAATTGCATCAGCTAATAGCCATAAAATATTTTAAGATTGATTAGATAAAGTTGAA
TGAAAATATGTTTAATTTTCTTTGAGTTTTTAAAATTTTAAATTTATAGCGTTTCAATCT
AATAAAAAAAATAATTAAAAATATTTAGGGTTAAAAGTCATATGTTGTTAGAGCAGTAGC
TTTTTCTCCAGATAGTGAAAAGGTAGCAGTCGCATAATCAGATAATATAGTTTTTGTCTA
TAAGATTGGCAAGGAATGGGGTGAAAAAAAATCTATTTGTAATAAATTCCCAACTTCTTC
CTCAGTAACATGTCTTTGCTGGCCTCATGAACGTGCAGGAGAAGTTATTTTTGGTTTGGC
TGAAGGTAAAGTCAAATCCGGTATCCTTCGTTCAAACAAAGTAATCAACTTAATTTATCA
AAAGGCGTGAAGCATTTATTCAATTTTTGTTTATAACAACAGTCATAAGTAATGTATTCA
ACTGATAGTTATGTTGTTAGCTTAGCAGCATGTAAAGACGGAGAAAATTTTGTAAGCGGT
CACTTAGATGGTACAATCTACGCATTTGGAAAAAAAATTGTAGTTCATCATTCAATCCCA
TATGCTTTAGGCTGGGGAGAACATGTTGTCGCTGCTGGTAATGATGGAAAGGTTTCTTTT
TACGATGCTTATGGCAATCATATTTAACGTTTTGATTATACAAATGATGATAAAATAAGA
GAATTCACTATAGCCGCATTCAACCCATCTGGCGACACAGTTGTTTTAGGCAACTTCAAT
AGGTAAAACATGAATTAAAATGCTATTTTAAACAGCAAAAAAAGAATTCTATTTTAAATT
GATAATATATTGGATGAAAGAAAATAAGACAGCTTAAGGAGAATAATATTTTTATATAGA
AGAAAGATTTAATTAGGAAGTGACTATTTAAAAATTATTTGAAATCAAAATAATAAAAAA
TCATCATCATCATTATCTAACAAATATTAATAAATACTAACTAAATCATCATTTTAAGTT
ATTCTTATTAATCAATTATTTCAATGCAAATAAATTATTTGAATGCTTGTTTCACTTTTT
CTTTCTTTTATTCATTTTTTTTTTTTTGAATTGTAAATCAATTATATTTTTATATGTTAG
ATTTTATATCTATCATTACAACTCCAGAAGAAGTCTCTGGGAAGAAATTGGTGTTAAATA
AATTGAAAATTATTATACTGTTACAGCTCTTGCATGGAAAAACGATGGTTCTAAATTAGT
AACTGGTTCTCTTTGCGGAAGTGTTGATTGGTACAATGCCTCATTTAAAATGATTAATTA
TAAGGGAAAGTTTGAGTTGAATTATGTGTCTCCTTCATAAATTGTAGTCAAAACATTATC
ATCTGGTAGAAAATCTGTTGTTAGAAGTGCCTAAGGTGCTGAAATTACCAAAATCAACAT
TTTCTAGGACCGTTTTGCAGTTGGTAATACTTATGATACTATCATAGTAGCTGATTTAGA
AGTTGATAAATGCTCAGAAATTCCATGGAGAAATGATGGTAAAGAAAAGTATGACTTTTC
AAATCCAGGAGTCTGCATGGTTTTTAGCAGTGGAGAATTGACTTTGATCGAATATGGAAA
CAATGAACCTCTTGGTAACTGCAGAACTGAGCACATGAAAACTAATTTAATTTCTGCTAG
ATTAAACTACCACAGTGTGAAATAAACTAAAATGATTGCTTATCTCTTAGATTTGCAAAC
CATTTACATTTAAGATCTCATGAGTAACTCAAATATTGGTTAGATTCTTCATGATTCGAA
AATTGATTTCTTAGAACTTAACACTCATGCTAATAAGCTCTTGTTTAGAGACAAGAGAAG
ATAACTCTACCTTTATAATATCAAAACTTAAACTAAAAATACTCTTCTCAGTTACTGTAG
TTATGCTTAGTGGGTTCCTGAATCAGATGTAGTTGTTGCTTAAAACAGATAAAACCTATG
TGTTTGGTATTCAATTGAAAATCCAGATAAAGTCACAATCTATAACATTAAGGGAGAAGT
TGAGTCTATTGAAAGAAATGGAGGTATAAAATGAATAAATAAATAAATAAAATTGAATAT
TTGTTAAAGAAAAATATTTGTATTAATAGGTAAGACTGATGTGATGGTAAATGAAGGAAA
TAATGTAGTTCCTTACAGCTTAGATGAATCTCTTATTAACTTTGGTTTTGCAATTGAATC
AGGAGATCTTGAAAAAGCAGCTACAATTCTTGACCCATTAGAGATGAATGCTGACACAGA
AGCTAACTGGAAAACATTATCTAAGTTAGCTCTTGAAGAGTAAAATATTATAGTTGCTGA
GCACTGTTATGCTTCTTTAGGTGATATTTGCAAGGCTTCTTATTTAAGAAAGATTTCTAA
GCTTGCCAGAGAAAGTGAAGAAGGTATCAATTACTACAAGGCTCAAGCTAAGCTTGCCAT
CCTCGATAAACAATTCCACAGAGCTGAAGCTATTTTATTAGATCATGAAGAGGTTGAAGA
AGCTATGGAAATGTATTAGGAACTCCATAAATGGGATGAATCAATTAAGATTGCTGAAAA
GAAAAACCATCCTTAGGTTAGAGAACTCAAGGAAAATTATTACACTTGGCTTCTAAAGAC
AAAGTAGGAAGCTAAGGTATAGTTTAAATTTTACAAGTTCTAATATTTTATTTAATTTTT
AATTTTAAAAAGGCTGCTGAAGTTAAGGAAAATGAAAGAGATTTTAACAAGGCTGTCTAG
CTCTACTTACAAGGTAATCTTCCAGCTAAAGCTGCTAATGTAGTGTTTACATATGATCAC
TCTTTCCCTTAGGACATTCTCGAAAATATTGCTGTAGCTCTCAAAAACGCAGGAATGTAT
GAAAGAGCTGGTGAATTCTATGAATAAATGGAATAATATCCTAAAGCTCTCTAAATGTAC
CGTGAAGGAAATTCTTACAAAAAAGCAATCGATCTTGCTAAAAGAGTTCAACCAAATTTA
GTGTAAAAATTATTAAAATTCTATTTGAAATTCAATTTAAATTAAAAAGATTAAATTAAT
AAACGAGGAAAATAAAATATAAATTAATAAATCAAATATTTTAATTAATTAAAGAAATTT
TATTTATTAATTTTCAAATCAAATTTCTCTATTTCACAAATGTTATTAATTTTTAATTAT
ATATATAGCCGTGAATTAGAAGAGAGGTGTGGTGATTGGTTAGTTAGCTAAAAGTAAACT
GAAAGTGCTGTTAATCATTATATTGAAGCTGGATCTTTCTAAAAGGCCATTGAAGCTAGT
ATCAATTCAAGATAATGGAGCAAGGCAATCTAACTTTTATAACATTAAAGTCCTGAAATG
GCTCGTCCTTTTTATAGACAAATTGCTAAGCATTATGCTGATGTTCGTCAATATGATTTT
GGTGAGAAATATTATTTGAAGGCTGGCTTAGCTGTTGAAGCTTTTGAAATGTATGCCAAG
GCTTCAAAATGGGAGCATGCCTTACGTGTTGCTCGTGAAAATCTCCCTGAAACTGAAATT
GTCTAATTATATGTTAAATAGGCTATCAAATTCTAGGAACAAAACCTCTATAAGGAAGCT
GAAAAACTCTACTGCTAAGTAGATGAGTATGATCGTGCTATTGATATGTATTAAAGAAGT
GAGTAGTATGAATCTATGCTTCGTTTAGTAGCTAAATATAGACCTAAATAATTAAGAGAT
ACTCATTTATAAATTGGTCAAAGATTATAGCGTGCTGGAAACTTGAAATAAGCAGAACAT
CACTATATTGAAGCTGGTGCTTGGCATGCTGCTGTTGACATGTATCAATCTAATGGAAAT
TGGGAAGATGCTGTCAGATGCTGCAAGCTTTATGGATCTGATAAGGAAACATGTGAACTT
GCTAAATAATGGGCAGAAACTTTGGGTCCTGATGCTGGTATGAAAATTCTTTTAAAATAC
AATTTAATCGATGCTGTCATTGAATATCTTTGTGATAGAAAGGAATTCGATGAAGCTTTT
AGAATGGCTCAAAAGGCTATCCATAAAAAGCCTGATGTTCACCTCAAATATGCATTTGAA
CTTGAAGATAACAAAAGGTATTTATTTATTTATTTATTTTAATATTTTTGAGAAAATTTT
TATTTAATAAAATCAAATATTTAGATATAAGGAAGCTGAAGAACACTTTATTAAGGCAGG
TAAACCTGAAGAAGCTATTAATATGTATGAGCATTTGAGTGATTTCTAAGCTGCATTATA
GGTAGCAAAAGTACACTAAAAATAGAGTATAAGCATGATTCTTATGAATTAAGCTCGTAC
TTTCATTGAAAAAAGAGAATATAAGAAGGCTGAAAACTGCTTTATCCAGGCTAAGAAACC
AGAATTAGCAGTTAAAATGTACAAGGATATTTAAAATTGGTAAGAAGCCTTCAGAGTAGC
CAAAAAGGAAGCTCCTCATTTAGTTTCAGAACTTACTTCTTAACATTAATAAGTTGGTAG
AGGAGGAGCTATGACTGGTGAAGACTATATCTAAAATGCTAGAGTATCTGAAGATAGCAG
AGATTACAACAAGGCAATAGATTCTTACCTCAATGTTACTCCTGAAAATTGTGATGAAAA
TACAGTTGTAATAATAAAAAAATTAAATTTAAGAAGAATTTTTTAAGATTTTTAAATATA
ATTTATTTAGGTAGCAGTCTGGAATAAAGCTATATAAATTGCCTAAACTTATGTTAAGGA
AAGATTGCAAGAAGTTGTCTTAATTGTTGCAAAGGGATTATAAAATTTAAATAAAGCTGA
TTAGGCTGCTGATATTTATGAAAACTTTGGATTCTACTAAGAAGCTTCATAACTTTATCT
TGAATTAAGAAATTATGCCAAAGCTAAATAATGTGCCTAATAAGTCAATAATCCTAGTGT
AATTTTTATTTTTGGTGCAGAAATAATTTATTTAAACAAATTTAAAAAAAAAATAATTAA
AGTTCTAGTAGAAGATGATAGCACGTATCTAATAACTTCAAATGACTGAATAATAAAACA
CAGGAGATACTAGAGGTATGATTGAAGGTGGTCATGTTGACTAAGCTATAGAAATGATGA
TTTAAAAAGGAGGTAACAAAATTATTTGATTTTAAAATTATAAATTAAAAAAAATTAATT
TCTAATAGTTCTAACAAAAAAATTTTGTTTTCTTAAATTTTAAGTTTAATAAGATAAATG
TTCTGCATACAATTAACATGAATATGAAATAATAATTTTATTCAATAAATTAGCTTTTTT
ATTTATTTAAATAAAAAAATGCCAAACATTTTACAGAAAATAACATGAAATGTTTTAAGG
CTTAAAATATTATTTTTAATTAATTACAAAATTTATAAATTAAATATTATGATTTTTAAA
CATAGATTGGAGATAGGCATTAGACACAGCTCAAAATCAGGGTGCAGAAATACTAGCCAA
GATAATGAGACGCTATGTCAAATTTACTATGGAAAGTGGTAAATTTGGTGAAACTATTGA
AGCCTATGCTCACTACGGCATGCAGTTGATTCCTGAAAACTTTAAGCATTACATTAACCT
TTGCTTAGAAATATTTGTTGAGTGCGATCCTAAAGAAATCAACAGCTTGCGTACTGCTTT
ATATAACTTTTACAAACTCTTATAAGGCTCTAAAGTAGACTAGTCTCAAGAAGGAAGATA
ATTCTAAAGGTACTTAACCATAGCACACTTAGCAAACCTAAAGAATGTTTATGAAAAGAA
AAATATGAGTGCTCTTTATGCTAGAACTTCAATTTCAATGCTTAGATACGGAGATCTTAT
TCGTATGGATAAATTGTTCTATGATGCAGGTGTTGCTTGCAAAAAATAAGTAAAAATTTT
AAATAAATATTAAATTAAATTGATATTATATTATATTTTTCATTATCAAAATATTTAAGA
AGTAACAAAACGACTTTATAATTTTCTTCATAAAATGTTTTAAATTTCTTTATCTTTTAC
AATATTAATAAATATCTTAATGAATAGAACTGGCTCACATATGCATTCGTCATCTTAAAT
AGATACTTAGATATCTTTGAAGTCATAGAAGATCCTAACAGTGCTGATACTGGAGATAAC
TAAGTCTTCTTAAATACTGATATTCCATCTCCTTATTAAGTAGAACTCATTCCTGAAAAG
AACCTAGTAGACTCAAATCAAATTGAAGGAATACGTAATTGGATTTTGGAAGTTAGTTGC
AATTCTAAAATAGAAAAGGACTTACCTATCCGTAGTTGTGAAAGCTGCAGAACTTAAATA
TATGAAGGATGCCAAACATGTCCTAAATGTAAAACTGAGGCTGAAGTTTGTATCCTAACA
GGATAACCTCTTTTAAAGGGAACATTCGTTAACTGTAGAAGTTGCGGAAAAGGAGGTCTC
AAAGAATATTGGTCGATGTACTTATAAAACTTTGCAAACTGTCCTTGGTGCAATAATCCC
CCAAATTGA