Identifiers and Description

Gene Model Identifier

TTHERM_00694540

Standard Name

IFT122 (IntraFlagellar Transport 122)

Aliases

PreTt02937 | 107.m00117 | 3753.m00409 | IFT122A

Description

Intraflagelar transport protein; plays a role in returning IFT proteins from the ciliary tip to the cell body during ciliary regeneration

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Biological Process

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 11.1%

TetraMine Data

TTHERM_00694540

WebApollo

Fullscreen View

Tetrahymena Stock Center

  • ( SD01787 ) Micronucleus: Neo3 into coding of IFT122A
  • ( SD01791 ) Micronucleus: Neo3 into coding of IFT122A
  • ( SD01792 ) Micronucleus: Neo3 into coding of IFT122A
  • ( SD01788 ) Micronucleus: Neo3 into coding of IFT122A and of IFT172
  • ( SD01789 ) Micronucleus: Neo3 into coding of IFT122A and of IFT172
  • ( SD01790 ) Micronucleus: Neo3 into coding of IFT122A and of IFT172

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Stentor CoeruleusSteCoe_284140
Tetrahymena borealisEI9_18435.19.997093137033517e-262hypothetical protein (1253 aa)
OxytrichaContig19231.0.g399.997093137033517e-262WD domain, G-beta repeat
WormBaseWBGene000009067.998663834726165e-156locus:daf-10 status:Confirme
d UniProt:G5EFW7 protein_i
d:CAB05177.4
DictyBaseDDB_G02930700.0000007997233352734267DDB_G0293070 on chromosome: 6
position 2426564 to 2433958
SGDYBR198C0.000019995566179747357TAF5 Subunit (90 kDa) of TFIID
and SAGA complexes, involved
in RNA polymerase II transcrip
tion initiation and in chromat
in modification

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:18199688: Tsao CC, Gorovsky MA (2008) Different effects of Tetrahymena IFT172 domains on anterograde and retrograde intraflagellar transport. Molecular biology of the cell 19(4):1450-61
  2. Ref:18211962: Tsao CC, Gorovsky MA (2008) Tetrahymena IFT122A is not essential for cilia assembly but plays a role in returning IFT proteins from the ciliary tip to the cell body. Journal of cell science 121(Pt 4):428-36

Sequences

>TTHERM_00694540(coding)
ATGAAGTGTTCAGAACTATGGACGGAAATCATTCCCAAGAATGACCCCAATTCTAATATA
ACAAATCAAGTATGGAGTTGTAGCTTCAATAATGATGGCTCTATATTATTAGCTTGTGTA
GGAGATGCTATTCTTGTATACGATTCATTTACTGGCAATTTAGTAAATAAAGCAATTAGA
GGAGGATAAAAGGAATAAATTAATTGCATCAAGTTCTCAAAAGATGGAAAAAGGTTTGCA
ACTGCTAGTAATGATAAAACTGTTTGGGTCTGGTCATTCGATGTAAATAAAAATCCCAAA
TTAGCACCTGAAGTAAAATATTCTCATACAGATAAGGTTTTATGTCTTGCTTTTAATCCA
TTGACGCATCAAATTTTCTCTGGAGGTGCTTAGGACTATGCTTTATGGACTCCAGATCAA
CAAAGTATAGAAAAATCTAAATTTAAAGATAAAATAATAACTTGTGCATGGAGTTGGGAT
GGTTTATATTTAGGTTTTGGTACTATGGGAGGTATTATTGGAATAAGAAACAGAGCTCTC
GAATAGTTAGCAGAAATTTAAAGGTCATTCCCTATATGGTGTATGGATTGGACGCCAATT
ACTCCTGACTATTAAAACAGTGTTCTCGTAGTAGGTGTTTGGGAATAGTCAATAGCTCAC
TATAATATTTAAGGTCAATAATTAGGTTCGGATAAAAAGCTTACATATGATCCTATAGAT
ATCAATTTTAGCACTCAAGGAGAATTCCTTTTAGTAAGTGGAACTAATAACAAATGCACT
CTATACACCAGAGAAGGTGGCTTTTTAATAGATGTTGCAACAAAAAATGATTGGGTTTGG
AATAATAAATTGAAACCTGTAATTAAAGAAGCTGGATCTGTTGCTGTTTAAGATTAGTTA
CACGTTGCTTTAACTACAAATGATGGCGAAATCAGTATGTTTAAAATTCAATAACTAACA
GTGCATGCACTTGAAGGTGATAAATATGCTTATAGAGATAATTTAACAGATATTGTTGTT
TAGAGCATGAGCTCAAATTAAAGAATTCGTTTGAAATGCAAAGAACTAGTTAAGAACATT
AGTATATATAAAGATAAGCTTGCTGCTCATTTAACAGAAAGAATTTTGATTTATGGAACT
TCTTCAGAAGATAGCTAAATGAAATATAAGTTGCATAAGAGAATAGTTAAAAAAGTTGAA
GCTCATATCTTAGAAATAGTTTCAAATCACTTGATAGCTTGTGTAAAAAATAAAGTATAA
TTATATTAATTATCAGGAGATTTAGAAAAAGAATGGGTTTTTGACTCAAGAGTTAATTGC
ATTAAAATTATAGGTGGAATGCCTAACAAAGAAGGAGCTTATGTCGGTTTAAAGAACGGT
TAAATTTTCAAAATATTTGTTGATAACAGTTTCCCTATTCCTATATTAAACCACAATATT
TCTATTAAAAATATTGATGCTTCTCAAAAAAGAAAAAGATTAGCAGTTGTTGATAAAAAT
AGCAACCTAACTGTTTATGATCTTTCAAACAAAGAATAAGTCTTCTAAGAAATGAATATT
GTTTCTTGCGCTTTCAACAATAATTTTGATGACTTGCTTGCTTTTTCATCAACTGACACA
ACATTTATCAGGTGCTCTAATCATCCACCTCTATCTCAAAAAATATCAGGATAAGTTGTA
GGATTTAAAGCAAATAAATTATTTGTTTTGAATGACAATGTTATGAGTACAATTGATGTT
TCGATGACTTAGACTATGATTAAATACTTAGAAAGAAAAGAATTTTAATCTGCATATGAA
ATATCTTTATTAGGAGTAACTGATTAAGATTTCTTATATTTAGGTAATGAAGCATTAATC
GCAACACAATTTGCTATTGCTAGAAAATGCTACACAAGAATAAAAAAATTAGACTTCATC
TATCTCCTTGAAAAGGCAGAAAAAGATTTTAAAAAGAATACATTTGTTGAGGGATTCTAT
TAAGGTGAGATATATGCTTTATAAACTAAATTCTATGAAGCAGAAAACGCACTCACTAAG
TCAAATTTAGCTTCTTAAGCAAAAGAAATGTGGATCATTCTTAAGGAATTTGATAAGGCT
ATGAGAATTACAGATACTGGTGCTAGTCCTATTAATAGAGGCCAGAATAAAGAAATAAAT
TCTGATGCTTCTAGAAAGGACCTACTCATTTAGAGGGCAGAATGGGAAGTCAAACAAGGA
AATTGGAAAAAGGGTGGTGAATTGTACATTCAAGCTGAAGTATATAAAAAGGCTATAGAA
GTATATGTAACCAATAATTTCTCAGAAGGTATTGTTGAAGTTTGCAGAAACGCAGATGCA
GAAACTCAAAGAAAAGAAATAGAATAATGTGCTGCATACTTTAAGAAAGCAAAACTTCAT
CAATACACAAAAGAAGCTTACTTGAAGCTGTAAGATAACAAAGCTTTACTTTAATTGAAT
ATTGATCTAGAAAAATGGGATGAAGCTATGACTCTTGCAAAGGCTCATCCTGAATTCATG
GAGATAGTCAAACTGCCTTATGCCAATTGGCTTGCTAAATAAGATAGATACGAAGAATCT
TTAAAGGCATACAGAAAAATTGGTAAACATGATATGGCTACTAAGATGCTCTATAACTTA
TCTTAGAATGCTGTATTTGAAAAAAGATTCTCTGACGCTGCTTTATTTACTTGGATGATA
GCTACTGAGCACTTAGGTTTGATTCGTAATATGAAAGCTCCAACCCCTGAAGATATTGAG
AATTTAATGAAATTTTATTAGTACAGAGATGATGCTGAAATATATTTTGCATACTCCAAA
GTTTAATCTTTTGTTGATGAACCATTCTTACCTTTATCAGGTCATGCTTACATGTTAAAT
ATCTTCAATGCTGCTCGCTTCGCCATAAACAAACTAGGAAACAGGCAGTTATACGGAGTC
TAACACAGTTATCTCTATTATTCATTAGGAAAAGTAAGTAAATAGCTTGAAGGTTACAAG
ACAGCCCGTATTTGCTATGAAAAACTAGCTAGCTACAAAATTCCTACTGAATGGAGCGAA
GAAATAGAATTAAGTACACTCTTAATTAGATCTAAGCCATATAGTGATTAGGAGTCTTTA
CTTCCTATTTGCAATAGATGCTATAATTAAAACCCAGCTCTCACAGAAGGTAACAGATGT
TCTTCTTGTATGCACTAATTTTAAAACTGCTTCATAAGCTTTGAAAATCTACCTTTGGTT
GAGTTTAAATTGGATCCTAAAATCACACATAAGAGATTTATTGAATTAATCAATTCTGAT
AAATCAAAAACACAACCTAATAAAAAGAAGAAGAAAGCAAACGACGGATGGTAAGAATCT
CACTAAGGAGATTAATAAGTTCTCACCTTTAACAATTCACCTTAAAAAGGAGGAAATGAC
AATGAAAGCAGTCCTTTCTTAGATAAACTTAACGAAGTATTCGAAATTTAATAAACTACT
TAAGAATACATACCTGTTACATTAGATGAAAATATAGTATCATCTCTTAGTATAGATGAG
GTTTATTGGGTAGACTATACAAAATATTGCTACACAGCAGAAATAAAATATTACAAGAGT
ATGTTAACAGACATTCCTCTCAAGAATTGTTAAGAATGTGGAACATTCTACATTTTGGAT
GAATATGAATTTGAAATAAGTAAGACATAAAAATGTCCTTTCTGCAGATCAGTTGATGAA
AGAGCAGGACCTTAGAAGGATGTTTTTGATTTCTGA


>TTHERM_00694540(protein)
MKCSELWTEIIPKNDPNSNITNQVWSCSFNNDGSILLACVGDAILVYDSFTGNLVNKAIR
GGQKEQINCIKFSKDGKRFATASNDKTVWVWSFDVNKNPKLAPEVKYSHTDKVLCLAFNP
LTHQIFSGGAQDYALWTPDQQSIEKSKFKDKIITCAWSWDGLYLGFGTMGGIIGIRNRAL
EQLAEIQRSFPIWCMDWTPITPDYQNSVLVVGVWEQSIAHYNIQGQQLGSDKKLTYDPID
INFSTQGEFLLVSGTNNKCTLYTREGGFLIDVATKNDWVWNNKLKPVIKEAGSVAVQDQL
HVALTTNDGEISMFKIQQLTVHALEGDKYAYRDNLTDIVVQSMSSNQRIRLKCKELVKNI
SIYKDKLAAHLTERILIYGTSSEDSQMKYKLHKRIVKKVEAHILEIVSNHLIACVKNKVQ
LYQLSGDLEKEWVFDSRVNCIKIIGGMPNKEGAYVGLKNGQIFKIFVDNSFPIPILNHNI
SIKNIDASQKRKRLAVVDKNSNLTVYDLSNKEQVFQEMNIVSCAFNNNFDDLLAFSSTDT
TFIRCSNHPPLSQKISGQVVGFKANKLFVLNDNVMSTIDVSMTQTMIKYLERKEFQSAYE
ISLLGVTDQDFLYLGNEALIATQFAIARKCYTRIKKLDFIYLLEKAEKDFKKNTFVEGFY
QGEIYALQTKFYEAENALTKSNLASQAKEMWIILKEFDKAMRITDTGASPINRGQNKEIN
SDASRKDLLIQRAEWEVKQGNWKKGGELYIQAEVYKKAIEVYVTNNFSEGIVEVCRNADA
ETQRKEIEQCAAYFKKAKLHQYTKEAYLKLQDNKALLQLNIDLEKWDEAMTLAKAHPEFM
EIVKLPYANWLAKQDRYEESLKAYRKIGKHDMATKMLYNLSQNAVFEKRFSDAALFTWMI
ATEHLGLIRNMKAPTPEDIENLMKFYQYRDDAEIYFAYSKVQSFVDEPFLPLSGHAYMLN
IFNAARFAINKLGNRQLYGVQHSYLYYSLGKVSKQLEGYKTARICYEKLASYKIPTEWSE
EIELSTLLIRSKPYSDQESLLPICNRCYNQNPALTEGNRCSSCMHQFQNCFISFENLPLV
EFKLDPKITHKRFIELINSDKSKTQPNKKKKKANDGWQESHQGDQQVLTFNNSPQKGGND
NESSPFLDKLNEVFEIQQTTQEYIPVTLDENIVSSLSIDEVYWVDYTKYCYTAEIKYYKS
MLTDIPLKNCQECGTFYILDEYEFEISKTQKCPFCRSVDERAGPQKDVFDF


>TTHERM_00694540(gene)
ATGAAGTGTTCAGAACTATGGACGGAAATCATTGTATTTTTTTTAAACACTAGCAACCAT
TATTTATAAAGAGAATAATTTTATTCCACTCTACTTTAAAAAAATTGATTAATGATCACA
ATAAAAAATAAAAAAATAGCCCAAGAATGACCCCAATTCTAATATAACAAATCAAGTATG
GAGTTGTAGCTTCAATAATGGTATTAAAATTAAACATTTGCAAAATTCATTCAGAATTTA
AAGTATGTGCAGGATATTTATTCATACTTTATCATATAAATAGATGGCTCTATATTATTA
GCTTGTGTAGGAGATGCTATTCTTGTATACGATTCATTTACTGGCAATTTAGTAAATAAA
GCAATTAGAGGAGGTAATTATAATTTTTTATAATTCATTAAATAGGGATAATTCTAATAA
TTTTTTTAGGAAAAAAGCTTTTCATTAACCATTATAATAATATAATTTATTGCTCTGCTA
AGTTAAAAATTAATGCTAATTATTTTTATGTAAATAAAGGATAAAAGGAATAAATTAATT
GCATCAAGTTCTCAAAAGATGGAAAAAGGTTTGCAACTGCTAGGTAATTAAGACTTACCA
ATAAAATATTCAAAACTACTAAATGGAGCTTGATAAATAGCTATAAATTGCTATATTATG
CAACTAATCCAATAATAAATTATTATAAATTTTTAAATTTTGATTGGATTTTGATATTAA
AATTTTATAAATTTTTAATGTAAATTTTAGTAATGATAAAACTGTTTGGGTCTGGTCATT
CGATGTAAATAAAAATCCCAAATTAGCACCTGAAGTAAAATATTCTCATACAGATAAGGT
TTTATGTCTTGCTTTTAATCCATTGACGCATCAAGTAATTAATAAATTTTTTCAATTATA
ATTCGAGTATTCAATTTATAATAAAAAATAAAAGATTTTCTCTGGAGGTGCTTAGGACTA
TGCTTTATGGACTCCAGATCAACAAAGTATAGAAAAATCTAAATTTAAAGATAAAATAAT
AACTTGTGCATGGAGTTGGGATGGTTTATATTTAGGTTTTGGTACTATGGGAGGTATTAT
TGGAATAAGAAACAGAGCTCTCGAATAGTTAGCAGAAATTTAAAGGTCATTCCCTATATG
GTGTATGGATTGGACGCCAATTACTCCTGACTATTAAAACAGTGTTCTCGTAGTAGGTGT
TTGGGAATAGTCAATAGCTCACTATAATATTTAAGGTCAATAATTAGGTTCGGATAAAAA
GCTTACATATGATCCTATAGATATCAATTTTAGCACTCAAGGAGAATTCCTTTTAGTAAG
TGGAACTAATAACAAATGCACTCTATACACCAGAGAAGGTGGCTTTTTAATAGATGTTGC
AACAAAAAATGATTGGGTTTGGAATAATAAATTGAAACCTGTAATTAAAGAAGCTGGTAA
TTATTAACTAATTTAAATAAATTCAATAGAGATTAATTTTTGTGTAAAAAATGTGTTTTA
ATTTTTTGTATGATTTAAATTTAACAGGATCTGTTGCTGTTTAAGATTAGTTACACGTTG
CTTTAACTACAAATGATGGCGAAATCAGTATGTTTAAAATTCAATAACTAACAGTGCATG
CACTTGAAGGTGATAAATATGCTTATAGAGATAATTTAACAGATATTGTTGTTTAGAGCA
TGAGCTCAAATTAAAGAATTCGTTTGAAATGCAAAGAACTAGTTAAGAACATTAGTATAT
ATAAAGATAAGCTTGCTGCTCATTTAACAGAAAGAATTTTGATTTATGGAACTTCTTCAG
AAGATAGCTAAATGAAATATAAGTTGCATAAGAGAATAGTTAAAAAAGTTGAAGCTCATA
TCTTAGAAATAGTTTCAAATCACTTGATAGCTTGTGTAAAAAATAAAGTATAATTATATT
AATTATCAGGAGATTTAGAAAAAGAATGGGTTTTTGACTCAAGAGTTAATTGCATTAAAA
TTATAGGTGGAATGCCTAACAAAGAAGGAGCTTATGTCGGTTTAAAGAACGGTTAAATTT
TCAAAGTAATTTTTTTTTAATGTGTAAAACTTCATTTTATTTAAATAATAAAATAAAGAT
ATTTGTTGATAACAGTTTCCCTATTCCTATATTAAACCACAATATTTCTATTAAAAATAT
TGATGCTTCTCAAAAAAGAAAAAGATTAGCAGTTGTTGATAAAAATAGCAACCTAACTGT
TTATGATCTTTCAAACAAAGAATAAGTCTTCTAAGAAATGAATATTGTTTCTTGCGCTTT
CAACAATAATTTTGATGACTTGCTTGCTTTTTCGTATTAATTTATTTTAATAAATATTTA
AATTTCATCGACTCATAATTTTTGATAATAAATAAATGTATAGATCAACTGACACAACAT
TTATCAGGTGCTCTAATCATCCACCTCTATCTCAAAAAATATCAGGATAAGTTGTAGGAT
TTAAAGCAAATAAAGTAATAAATTATTTTCATTTAACAATTAGTTTTAATTAAATTTGTT
TTATGAAATTAGTTATTTGTTTTGAATGACAATGTTATGAGTACAATTGATGTTTCGATG
ACTTAGACTATGATTAAATACTTAGAAAGAAAAGAATTTTAATCTGCATATGAAATATCT
TTATTAGGAGTAACTGATTAAGATTTCTTATATTTAGGTAATGAAGCATTAATCGCAACA
CAATTTGCTATTGCTAGAAAAGTAAATATTGAAAAATTAAAATGTTGAAAATAATATTAA
TTAATGCTTGATTAAATTTTTAATAAATTAGTGCTACACAAGAATAAAAAAATTAGACTT
CATCTATCTCCTTGAAAAGGTAAAGAAACAATTAATTAGTTTAGAATCAAAATGAACAAA
ATATTTTTTAATTTTAGGCAGAAAAAGATTTTAAAAAGAATACATTTGTTGAGGGATTCT
ATTAAGGTGAGATATATGCTTTATAAACTAAATTCTATGAAGCAGAAAACGCACTCACTA
AGTCAAATTTAGCTTCTTAAGCAAAAGAAATGTGGATCATTCTTAAGGAATTTGATAAGG
CTATGAGAATTACAGATACTGGTGCTAGTCCTATTAATAGAGGCCAGAATAAAGAAATAA
ATTGTAAATAATTCTTATTTTATTTTAGTTATTAATTTTTTAATTCCAGCTGATGCTTCT
AGAAAGGACCTACTCATTTAGAGGGCAGAATGGGAAGTCAAACAAGGAAATTGGAAAAAG
GGTGGTGAATTGTACATTCAAGCTGAAGTATATAAAAAGGCTATAGAAGTATATGTAACC
AATAATTTCTCAGAAGGTATTGTTGAAGTTTGCAGAAACGCAGATGCAGAAACTCAAAGA
AAAGAAATAGAATAATGTGCTGCATACTTTAAGTAAGCAAAATAATTTCAAAAAATTTAA
TAACATTTTAATTTAATTTATCAGGAAAGCAAAACTTCATCAATACACAAAAGAAGCTTA
CTTGAAGCTGTAAGATAACAAAGCTTTACTTTAATTGAATATTGATCTAGAAAAATGGGA
TGAAGCTATGACTCTTGGTAAGTTTTATATAAATCAAATTTGAGAGATAGATGAATATAT
TTTTGATTTTTTATTTTAGCAAAGGCTCATCCTGAATTCATGGAGATAGTCAAACTGCCT
TATGCCAATTGGCTTGCTAAATAAGATAGATACGAAGAATCTTTAAAGGCATACAGAAAA
ATTGGTAAACATGATATGGCTACTAAGATGCTCTATAACTTATCTTAGAATGCTGTATTT
GAAAAAAGATTCTCTGACGCTGCTTTATTTACTTGGATGATAGCTACTGAGCACTTAGGT
TTGATTCGTAATATGAAAGCTCCAACCCCTGAAGATATTGAGAATTTAATGAAATTTTAT
TAGTACAGAGATGATGCTGAAATATATTTTGCATACTCCAAAGTTTAATCTTTTGTTGAT
GAACCATTCTTACCTTTATCAGGTCATGCTTACATGTTAAATATCTTCAATGCTGCTCGC
TTCGCCATAAACAAACTAGGAAACAGGCAGTTATACGGAGTACAATTTCTTTAAAATTTA
TTAAAAATACTTAAAATCAAAAATTATATTATAGGTCTAACACAGTTATCTCTATTATTC
ATTAGGAAAAGTAAGTAAATAGCTTGAAGGTTACAAGACAGCCCGTATTTGCTATGAAAA
ACTAGCTGTATGTTCAAATTTATTATTATTATTATTACCAAGTTAAACATTATTTTAACA
AAAAGAGCTACAAAATTCCTACTGAATGGAGCGAAGAAATAGAATTAAGTACACTCTTAA
TTAGATCTAAGCCATATAGTGATTAGGAGTCTTTACTTCCTATTTGCAATAGATGCTATA
ATTAAAACCCAGCTCTCACAGAAGGTAACAGATGTTCTTCTTGTATGCACTAATTTTAAA
ACTGCTTCATAAGCTTTGAAAATCTACCTTTGGTTGAGTTTAAATTGGATCCTAAAATCA
CACATAAGAGATTTATTGAATTAATCAATTCTGATAAATCAAAAACACAACCTAATAAAA
AGAAGAAGAAAGCGTAATTAGATTTTAATAATTACTTGACTTACACTGACAATTCAAAAT
TAATTAAATTTTTTTTCAAAATTGGATGGAAATTATTAATTTGAACTGATATTTTGATTA
TTTCATAATAATTTGATTAAATAGAAACGACGGATGGTAAGAATCTCACTAAGGAGATTA
ATAAGTTCTCACCTTTAACAATTCACCTTAAAAAGGAGGAAATGACAGTAAAAGATTTTA
GCATGATTATTTAAAATTTATTATTTAAATCTAAAAAATATTAAGATGAAAGCAGTCCTT
TCTTAGATAAACTTAACGAAGTATTCGAAATTTAATAAACTACTTAAGAATACATACCTG
TTACATTAGATGAAAATATAGTATCATCTCTTAGTATAGATGAGGTAATTTCGTTTAATT
TTTAAAGAAAGATACAACAAATAACTAATGTATCTTCTCTTAAAGGCCCATTACAATTAG
CTAATTTTTTTAATAGGTTTATTGGGTAGACTATACAAAATATTGCTACACAGCAGAAAT
AAAATATTACAAGAGTATGTTAACAGACATTCCTCTCAAGAATTGTTAAGAATGTGGAAC
ATTCTACATTTTGGTAATTAATATCATTTTTTTTCCATATAATTACACACAAAAAAATTT
ATCAATTAGGATGAATATGAATTTGAAATAAGTAAGACATAAAAATGTCCTTTCTGCAGA
TCAGTTGATGAAAGAGCAGGACCTTAGAAGGATGTTTTTGATTTCTGA