Identifiers and Description

Gene Model Identifier

TTHERM_00691720

Standard Name

ICT1 (Integral-Membrane Cation Transporter )

Aliases

PreTt03010 | 106.m00150 | 3674.m00063

Description

NRAMP family Mn2+/Fe2+ transporters containing protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

  • ( PF01461 ) 7TM chemoreceptor
  • ( PF07695 ) 7TM diverse intracellular signalling
  • ( PF07690 ) transporter, major facilitator family
  • ( PF01566 ) Natural resistance-associated macrophage protein
  • ( TIGR01197 ) metal ion transporter, metal ion

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00691720

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_17571.19.997093137033517e-262NRAMP family Mn2+/Fe2+ transpo
rters containing protein (488
aa)
OxytrichaContig20600.0.g693.999836123447869e-144Natural resistance-associated
macrophage protein
DictyBaseDDB_G02769732.0007666164339447e-112nramp1 on chromosome: 2 positi
on 7564058 to 7565770
WormBaseWBGene000048766.000988504514371e-99locus:smf-1 NRAMP-like trans
porter smf-1 status:Confirme
d UniProt:Q21434 protein_i
d:CCD70800.1
SGDYOL122C9.002663577881587e-59SMF1 Divalent metal ion transp
orter with a broad specificity
for di-valent and tri-valent
metals; post-translationally r
egulated by levels of metal io
ns; member of the Nramp family
of metal transport proteins

General Information

Paragraph NoGene NameParagraph Text
43ICT1Tetrahymena thermophila ICT1 is homologous to the natural resistance-associated macrophage protein (NRAMP) family, composed of membrane proteins that are divalent cation transporters. It contains one domain (E-value=3.7x10-108), which is located in the middle of the protein. Given the function of the homologous proteins, it is likely that ICT1 is an integral membrane protein and functions as a cation transporter. Paragraph by: Alec Koh and Katherine Tully (undergraduates), Keck Science Department, Claremont McKenna College and Scripps College.

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00691720(coding)
ATGGCTGAAGTAGGATAGAACAATATCAATTCTGGAACTGTTAACAGCAATGATCATTAA
GAGAAAATTAATGTAAAGTTTTCATTAAGGGAATTTTTCTAATATTTTGGACCAGGCTTA
CTCGTAGCTATCGCTTACATCGATCCTGGTAATTTGGCTGGTGATATGGATGCAGGTTTA
AATGGTAAATATCACTTGTTATGGGTACTTTTCTTATCAACACTCTTAGGTTTCTTCTTT
TAAAACCGTGCTATGATGATTGGTTTGGTTACTGGAAAAGATATGGCTAAATTATGTCGC
TACTATTATCCTAAAAAAATGTCTATCTTGTTATGGATTATGGCTGAAATCGCTATTATA
GGCAGTGATATTCAAGAAGTATTAGGATCTGCTATTGCATTATAAATTCTTTTTGGACTC
AAATTATGGATCGGAGTTATCTTAACTATTTCTTCTACTATTCTTATTTTATTAATAAAA
TATGTTGGTATGCGCTTTTTAGAATTAATCTTTGGTATTCTTATAGGAACTATGGCTATT
TGCTTCTTTATTGATCTTGGTTACATTGCTCCTAATTTCGGTGAATTAATGGAAGGAATG
TTTGTCCCTTACATCCCATCATCTGCACTCACTTCCATGGTTGGTTTAATAGGTGCTGTC
CTCATGCCTCACAATCTATATCTTCATTCATCTCTTGTTTATGAAAAGAAGATTTCCAGA
AATGACAGACCTCTTCTCCATAAATCCATTTTTTATTTCAAAATTGAAACAGGTATCTCT
CTCCTAATTTCTTTCTTCATAAACATGGCAGTCATTGGTACTTTTGCTAATTGGTACAAT
AGTGGAACAGATATTGATTTAAGCTCTGCTGCCACAGTCCTTGAAGAAAACTTTGGTGCA
GCTGCCAAGTACATTTGGGGTATCGGTTTATTGGCTGCTGGTTAATCATCAACTTTAACT
GGTACTCTTGCTGGTTAATTTGTCATGTCTGGATTTGTTAAAATGAGAGTAAGCAAGTTC
AAAAGAGCTTTTATTACTCGTGCTATTGCAATCGTTCCTGCTATTGTTATAGCTTTTATT
GCTGATGATGAAGACTTTAATAACTATTTAAATATTCTTCAAGCAATACAACTTCCCTTT
GCCGTTATTCCACTTCTTAAGCTTTCAATGGATAGAGAACTCATGGGTGAATTTACTATT
GGTAAAGTTCAATTAACTTTATTGAGTGTCCTTTCCGCTGCTATTGTAGGAGTAAACTAT
TACGCATCAGTACCTGATGAAGTAAACTGGTCTGAAGCTTGGATCTATATCATTCTCGTA
GTTATGGTTTTATACTTTATCTTTTTAGGAATCGTGCTTTTCACTAAAATTAAAGATACT
AAGGACGTCAAATAAAGTATGCTATCAAATCATAAGCAATCTTTAATTTAAGATGATGAA
TAATATCATGTTAAATAATGA


>TTHERM_00691720(protein)
MAEVGQNNINSGTVNSNDHQEKINVKFSLREFFQYFGPGLLVAIAYIDPGNLAGDMDAGL
NGKYHLLWVLFLSTLLGFFFQNRAMMIGLVTGKDMAKLCRYYYPKKMSILLWIMAEIAII
GSDIQEVLGSAIALQILFGLKLWIGVILTISSTILILLIKYVGMRFLELIFGILIGTMAI
CFFIDLGYIAPNFGELMEGMFVPYIPSSALTSMVGLIGAVLMPHNLYLHSSLVYEKKISR
NDRPLLHKSIFYFKIETGISLLISFFINMAVIGTFANWYNSGTDIDLSSAATVLEENFGA
AAKYIWGIGLLAAGQSSTLTGTLAGQFVMSGFVKMRVSKFKRAFITRAIAIVPAIVIAFI
ADDEDFNNYLNILQAIQLPFAVIPLLKLSMDRELMGEFTIGKVQLTLLSVLSAAIVGVNY
YASVPDEVNWSEAWIYIILVVMVLYFIFLGIVLFTKIKDTKDVKQSMLSNHKQSLIQDDE
QYHVKQ


>TTHERM_00691720(gene)
ATGGCTGAAGTAGGATAGAACAATATCAATTCTGGAACTGTTAACAGCAATGATCATTAA
GAGAAAATTAATGTAAAGTTTTCATTAAGGGAATTTTTCTAATATTTTGGACCAGGCTTA
CTCGTAGCTATCGCTTACATCGATCCTGGTAATTTGGCTGGTGATATGGATGCAGGTTTA
AATGGTAAATATCACTTGTTATGGGTACTTTTCTTATCAACACTCTTAGGTTTCTTCTTT
TAAAACCGTGCTATGATGATTGGTTTGGTTACTGGAAAAGATATGGCTAAATTATGTCGC
TACTATTATCCTAAAAAAATGTCTATCTTGTTATGGATTATGGCTGAAATCGCTATTATA
GGCAGTGATATTCAAGAAGTATTAGGATCTGCTATTGCATTATAAATTCTTTTTGGACTC
AAATTATGGATCGGAGTTATCTTAACTATTTCTTCTACTATTCTTATTTTATTAATAAAA
TATGTTGGTATGCGCTTTTTAGAATTAATCTTTGGTATTCTTATAGGAACTATGGCTATT
TGCTTCTTTATTGATCTTGGTTACATTGCTCCTAATTTCGGTGAATTAATGGAAGGAATG
TTTGTCCCTTACATCCCATCATCTGCACTCACTTCCATGGTTGGTTTAATAGGTGCTGTC
CTCATGCCTCACAATCTATATCTTCATTCATCTCTTGTTTATGAAAAGAAGATTTCCAGA
AATGACAGACCTCTTCTCCATAAATCCATTTTTTATTTCAAAATTGAAACAGGTATCTCT
CTCCTAATTTCTTTCTTCATAAACATGGCAGTCATTGGTACTTTTGCTAATTGGTACAAT
AGTGGAACAGATATTGATTTAAGCTCTGCTGCCACAGTCCTTGAAGAAAACTTTGGTGCA
GCTGCCAAGTACATTTGGGGTATCGGTTTATTGGCTGCTGGTTAATCATCAACTTTAACT
GGTACTCTTGCTGGTTAATTTGTCATGTCTGGATTTGTTAAAATGAGAGTAAGCAAGTTC
AAAAGAGCTTTTATTACTCGTGCTATTGCAATCGTTCCTGCTATTGTTATAGCTTTTATT
GCTGATGATGAAGACTTTAATAACTATTTAAATATTCTTCAAGCAATACAACTTCCCTTT
GCCGTTATTCCACTTCTTAAGCTTTCAATGGATAGAGAACTCATGGGTGAATTTACTATT
GGTAAAGTTCAATTAACTTTATTGAGTGTCCTTTCCGCTGCTATTGTAGGAGTAAACTAT
TACGCATCAGTACCTGATGAAGTAAACTGGTCTGAAGCTTGGATCTATATCATTCTCGTA
GTTATGGTTTTATACTTTATCTTTTTAGGAATCGTGCTTTTCACTAAAATTAAAGATACT
AAGGACGTCAAATAAAGTATGCTATCAAATCATAAGCAATCTTTAATTTAAGATGATGAA
TAATATCATGTTAAATAATGA