Identifiers and Description

Gene Model Identifier

TTHERM_01141570

Standard Name

ICL1 (IsoCitrate Lyase)

Aliases

PreTt20062 | 251.m00042 | 3821.m00564

Description

isocitrate lyase family protein; has similar domain structure to yeast isocitrate lyase 1 (ICL1)

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.6%

TetraMine Data

TTHERM_01141570

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_20883.19.997093137033517e-262hypothetical protein (504 aa)
OxytrichaContig20680.0.g939.997093137033517e-262Isocitrate lyase family
SGDYER065C2.0007442334946695e-153ICL1 Isocitrate lyase, catalyz
es the formation of succinate
and glyoxylate from isocitrate
, a key reaction of the glyoxy
late cycle; expression of ICL1
is induced by growth on ethan
ol and repressed by growth on
glucose
WormBaseWBGene000015642.998830401637127e-79locus:icl-1 status:Confirmed
UniProt:Q8IA71 protein_id
:CCD63239.1
DictyBaseDDB_G02730175.998439611888618e-47DDB_G0273017 on chromosome: 2
position 2236569 to 2237975

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_01141570(coding)
ATGGACGTTGAAGGAAAGAGACTCTAAGAAATCACTGCTGAAATCCAAAAATGGTGGACT
AACTCTCGTTGGGAAAATGTTGAAAGACCCTACTAAGCTTAAGATGTTGCCCGTTTAAGA
CCCACCATCCCCATGGACTACCCCTCCAACTACTAATCCAAGAAGATGTGGAAACTCTTG
AAGGAAGCCCAAGCCAACAAGGGATTCCACCACACTTTCGGTGCCTTAGACCCCGTTCAA
GTTATCAACTTATCCAAGTACTTGAGAACTGTCTACGTCTCTGGATGGTAATGCTCTGCC
ACTGCCTCCACTACTAATGAACCTGGTCCAGATTTTGCTGATTACCCTGCCAACACTGTC
CCCAACAAAGTTGACCAACTCTTCAAGGCTTAACTTTTACAAGACAGAATCCAAAATGAA
CAAAGAGCTCATTTGACCCCTGAATAAAGAGCTAAGACTCCCAGAGTTGACTACCTTGCT
CCTATGATTGCTGATGCTGATGCTGGTTTCGGTGGTATTACTTCAACCATGAAGTTAATT
AAGTTATTCATTGAAGCTGGTGCTGCTGGTATCCATCTTGAAGATTAAAGACCTGGTACC
AAGAAATGTGGTCACATGAGTGGTAAGGTCGTTGTCTCCACTCGCGAACACGTCAACAGA
TTAATTGCTTGCAGACTCCAAGCTGATATTATGGGAACTGATTTAATTATCCTCGCCAGA
ACTGATGCTTTATCTGCTAGACTTATTGACTCCAACTGTGACCCCGTTGACCACCCCTTC
ATCCTTGGTCTTTGCCCTGATGGTAAGGAAAGAACTTTCCCTAATGCAGGTCTTGAAGCT
ATCAAGGCTAAGTTCACTGGTGCTAAGGTCCAAGAAGTCACCAAGCTCTGGCTCTCTAAG
TGTTACGATCTTTCCCTCACTCAAGCCCACGAATACGCTAGAACTCTCGGTTTTGACTTC
CAATTCGACTGGGAAGCTCTCCGTTCATCTGAAGGTTTCTACTCCATTGACGGTTGTGTT
GAATTATGTGCTGCTCGTGCTAAGTAATATTTAAGATATGCTGATATGGTTTGGATGGAA
ACTCCTACTCCCTCTTTGGAAGTTGCTACTAAGTTCTCTACCTTGGTAAAGAATAACCAT
CCCACCAAATTATTGGCTTACAACCTTTCCCCCTCTTTCAACTGGTCTGCTTTCAACATG
TCCAATGCTCAAATCCAATCTTTCTGTGCTGACCTTGGTAGACTCGGATACACCTGGTAA
TTCATTACTTTAGCTGGTTTCCACTTGAATGCTCTCAAGTCTGAAAAGCTCTCTAAGGAT
CTTGCTGCCCGTGGTATGCTCGCCTACGTCGAAACTGTCCAAAGAAAGGAAGAAAAGCAC
AAAGTCGACCAACTCACCCACCAAAAATGGTCTGGTGCTAACTACGTTGATGCTTGCCAA
GCCCTTGTTCAACCCGAATCTCAAACCTTAGCCTCCTCCAAAGACTCTACTGAAAACTAA
TTCAAGCATTGA


>TTHERM_01141570(protein)
MDVEGKRLQEITAEIQKWWTNSRWENVERPYQAQDVARLRPTIPMDYPSNYQSKKMWKLL
KEAQANKGFHHTFGALDPVQVINLSKYLRTVYVSGWQCSATASTTNEPGPDFADYPANTV
PNKVDQLFKAQLLQDRIQNEQRAHLTPEQRAKTPRVDYLAPMIADADAGFGGITSTMKLI
KLFIEAGAAGIHLEDQRPGTKKCGHMSGKVVVSTREHVNRLIACRLQADIMGTDLIILAR
TDALSARLIDSNCDPVDHPFILGLCPDGKERTFPNAGLEAIKAKFTGAKVQEVTKLWLSK
CYDLSLTQAHEYARTLGFDFQFDWEALRSSEGFYSIDGCVELCAARAKQYLRYADMVWME
TPTPSLEVATKFSTLVKNNHPTKLLAYNLSPSFNWSAFNMSNAQIQSFCADLGRLGYTWQ
FITLAGFHLNALKSEKLSKDLAARGMLAYVETVQRKEEKHKVDQLTHQKWSGANYVDACQ
ALVQPESQTLASSKDSTENQFKH


>TTHERM_01141570(gene)
ATGGACGTTGAAGGAAAGAGACTCTAAGAAATCACTGCTGAAATCCAAAAATGGTGGACT
AACTCTCGTTGGGAAAATGTTGAAAGACCCTACTAAGCTTAAGATGTTGCCCGTTTAAGA
CCCACCATCCCCATGGACTACCCCTCCAACTACTAATCCAAGAAGATGTGGAAACTCTTG
AAGGAAGCCCAAGCCAACAAGGGATTCCACCACACTTTCGGTGCCTTAGACCCCGTTCAA
GTTATCAACTTATCCAAGTACTTGAGAACTGTCTACGTCTCTGGATGGTAATGCTCTGCC
ACTGCCTCCACTACTAATGAACCTGGTCCAGATTTTGCTGATTACCCTGCCAACACTGTC
CCCAACAAAGTTGACCAACTCTTCAAGGCTTAACTTTTACAAGACAGAATCCAAAATGAA
CAAAGAGCTCATTTGACCCCTGAATAAAGAGCTAAGACTCCCAGAGTTGACTACCTTGCT
CCTATGATTGCTGATGCTGATGCTGGTTTCGGTGGTATTACTTCAACCATGAAGTTAATT
AAGTTATTCATTGAAGCTGGTGCTGCTGGTATCCATCTTGAAGATTAAAGACCTGGTACC
AAGAAATGTGGTCACATGAGTGGTAAGGTCGTTGTCTCCACTCGCGAACACGTCAACAGA
TTAATTGCTTGCAGACTCCAAGCTGATATTATGGGAACTGATTTAATTATCCTCGCCAGA
ACTGATGCTTTATCTGCTAGACTTATTGACTCCAACTGTGACCCCGTTGACCACCCCTTC
ATCCTTGGTCTTTGCCCTGATGGTAAGGAAAGAACTTTCCCTAATGCAGGTCTTGAAGCT
ATCAAGGCTAAGTTCACTGGTGCTAAGGTCCAAGAAGTCACCAAGCTCTGGCTCTCTAAG
TGTTACGATCTTTCCCTCACTCAAGCCCACGAATACGCTAGAACTCTCGGTTTTGACTTC
CAATTCGACTGGGAAGCTCTCCGTTCATCTGAAGGTTTCTACTCCATTGACGGTTGTGTT
GAATTATGTGCTGCTCGTGCTAAGTAATATTTAAGATATGCTGATATGGTTTGGATGGAA
ACTCCTACTCCCTCTTTGGAAGTTGCTACTAAGTTCTCTACCTTGGTAAAGAATAACCAT
CCCACCAAATTATTGGCTTACAACCTTTCCCCCTCTTTCAACTGGTCTGCTTTCAACATG
TCCAATGCTCAAATCCAATCTTTCTGTGCTGACCTTGGTAGACTCGGATACACCTGGTAA
TTCATTACTTTAGCTGGTTTCCACTTGAATGCTCTCAAGTCTGAAAAGCTCTCTAAGGAT
CTTGCTGCCCGTGGTATGCTCGCCTACGTCGAAACTGTCCAAAGAAAGGAAGAAAAGCAC
AAAGTCGACCAACTCACCCACCAAAAGTAATTATAAAAACATTTTTATCTATATAAAATA
AAAAAAAATGGCTCTGATAAGTAGGTATAAATAAAATATTCAAATAATAGAGATAGACAA
TCATATGATCTTTTAATAGCAATTTATCAATGTTTAATATATCAAAAAAAGCAATAGAAC
AAACAAAAGCATTCATTCGATCTATTAAAAAATAAAAAGAATATTTTATTTATACACCTC
TATAATAAATTGCTAATTTTATTTACTCATTCATTTATTAAAATTAATTTGTATTAAATA
GATGGTCTGGTGCTAACTACGTTGATGCTTGCCAAGCCCTTGTTCAACCCGAATCTCAAA
CCTTAGCCTCCTCCAAAGACTCTACTGAAAACTAATTCAAGCATTGA