Identifiers and Description

Gene Model Identifier

TTHERM_00446430

Standard Name

IC6

Aliases

PreTt03910 | 51.m00276 | 3704.m00132 | IC138

Description

Intermediate chain subunit of ciliary two-headed inner arm dynein (IAD) complex 1

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

  • ( PF00400 ) WD domain, G-beta repeat
  • ( PF07334 ) Interferon-induced 35 kDa protein (IFP

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00446430

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_10806.19.997093137033517e-262hypothetical protein (919 aa)
OxytrichaContig21142.0.g1011.0002534232488231e-144WD domain, G-beta repeat
Stentor CoeruleusSteCoe_261121.2806276389220833e-57
DictyBaseDDB_G02808498.999219783133462e-31dicA on chromosome: 3 position
3856978 to 3859184
WormBaseWBGene000159271.9993007828132465e-27locus:dyci-1 status:Confirme
d UniProt:O45087 protein_i
d:CCD64991.1
SGDYBR198C0.000019995566179747357TAF5 Subunit (90 kDa) of TFIID
and SAGA complexes, involved
in RNA polymerase II transcrip
tion initiation and in chromat
in modification

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:16933976: Eisen JA, Coyne RS, Wu M, Wu D, Thiagarajan M, Wortman JR, Badger JH, Ren Q, Amedeo P, Jones KM, Tallon LJ, Delcher AL, Salzberg SL, Silva JC, Haas BJ, Majoros WH, Farzad M, Carlton JM, Smith RK, Garg J, Pearlman RE, Karrer KM, Sun L, Manning G, Elde NC, Turkewitz AP, Asai DJ, Wilkes DE, Wang Y, Cai H, Collins K, Stewart BA, Lee SR, Wilamowska K, Weinberg Z, Ruzzo WL, Wloga D, Gaertig J, Frankel J, Tsao CC, Gorovsky MA, Keeling PJ, Waller RF, Patron NJ, Cherry JM, Stover NA,

Sequences

>TTHERM_00446430(coding)
ATGGACGCATCAACATTAAGAGCTGGTACAACAAGAGCTAATATGTAAATGAGTTCAAAA
GCTGGACTCAAATCTGGTCCTACTATGGCAGGTAAAAAGCTAGCAGGTGGTACCACTAGG
TTGCCTTAGGGCAGTAAATCGTCCAAGCAAGCAGGATAGTCTAAGATGAAAACTACGGGA
TCAGAAAGAGATAATGAATATGTAATGGAGGGTAATGTTAATGTAACTCCTAAAAGGCTT
ATAACATAGTAAATGAAAGAATTAGCTTAAGAGTTTCAAAAGCACGAATAAGAATAAGCT
GAAAAATAAAAGAAATTAAAATAGTCATTTAAACCACAAACTTCATTATTAGAATCCTCG
ATGAGGAGTGCATAATAGAGCGTTGATAAGAGTTCTGGCAGTGAAAACAAAACAAGTAGC
GCAAATATAAAGGAGTCTTCTATGATGGATAGTAGTAGACGTTCCGAAATATATTCTGAA
TCAGAAGAAGAATCTAGACTTAAAGAGGAGCGTGAAAAGAAGGCAAAAAAGGCTAAATAA
CTTAGTGAAGACGATAAGGAAAAAGATGTCATAATCAATTTATAAGAATCTGAAACAGAG
ATATTATTATATATTCCATCTTCATTAGTTTCAAGCTCATCTGTACAAATAAATTAAAAC
TAAATAAGGGATGAAAATACCAAAAACCCAACTGCAATTATTTTAGAAAGAAACCAAAAG
TATGAATAACATTGCTAAGATATTATTGGCAGTGATAAGTTTTCTAAGAGAGCTGCTTAA
ACATTTAAGTATGCTCCTAAGTAACAGTAATAGTAATCTAATAGAATTGAAAGAGCTGAG
AAAGGTGTGTTTGCAGCTGTTTGGGATTTGTATGATGCATAACTATAAGAATAGTACAAC
GAATATGAATAACTATAAAATGAAATATAAAAAAATATTGATTTAGAGTTAAAGAAAGCT
CTAAAAAATCCATTTTGCTTACTTCCTCTTGATGTTAAATCTATCAACTTACACTCTAGA
GCTGAAGTACCTGGTGATACTCGTCTTTTGACTGAGAAAATGAGCAGTAAAACCTACAAG
CCAGGACATACTGCTTCAGTAAATAATAATACACTTAATCCTTCATAAGATGATACAGGA
CCTCGTGATTCTTCTTTCTCAAATTTGAAAGACGTTTCAGGCACTAAACTAAAGAGACAG
TTTGAAAGCTAAAATTTAGTGACAAAATCTTATGGTGGTAATAAGGTTCATCATGAGTAA
ATGCTTAAGTAACATAAAGAAACATTAGAAATTTTAAAGAAAGAAGAATAAAAGCTGATT
GAATAAAGACTTGAAAAAGTTAAAAATTAGATAAATGAGGAAGAACAAAAGATCATTTCT
AGTGATTCTTTATCGACATATTTAAAATATGTTGATAGAATTCTCAATCAAAATACTTAT
CATAAGTAATACATTTTGTATAGAAATTATCCTGAAGTCAAGATTCACAAAAGAGCTGAT
GATGAGGGTAACAAAAGATTCAACAATATGCGTATCAAGAGAATGAAGTAAGGTAATAAT
GAAGATGAAGATGAAGAAAAAGAAAAGAAAAAAGAAGTTTTAGAGTTCCTTTTCAAATTT
AATTGTGATATCACTTAGGATAGAACTGTAAGTTGTGCAGATTGGAATCCAGTTAATAAA
GATTTATTGGCTTGTACTTACGGTGAACTTGATTTGAATGTTAACAGACAAGGTATGGTT
ATGTTTTGGACACTTAAGAACCCTAGCTATCCTGAAAGAATTATCAAAACTAAATCACGT
TTAACTAGTTGTAAATTTTCTGAGATGAATCCTAATTTACTTGCTACAGGAAGTTATGAT
GGTATAGTAGCAATTTATGATATAAGAAAGAAGGGTAATCAACCAATCCTTTGTAACGAT
TAAACCGAAGGTAAGCATAGTGATGCCATTTGGGAGTTAAATTGGATTGGTAAAGGAAAC
AAAGGTAACGAAAAGGGAGAAAGCTTAGTCAGTATCAGCTCTGATGGTCGTATTGTTGAA
TGGAACATGAAGAAAGAATTAGAAAATACAGAATTAATGAGCCTTAAAAAGACATAAAAT
CCTTCTAGCAAAGAACAAGCAAATGAAGGAACTAATTTTAGATAGGCAGCTGGTTTTTCT
ATGGACTTCATTAGGGGAGAATACTCTACTTACTTAGCTGCAACTGATGATGGACCTATT
CATAGATGCTCTAAAAATTATTCTGGACAATATCTAGAATCGTACTTCGGACATACAGGA
CCTGTATATAGAGTTCGTTTCAATCCTTTTTGGTCAGACATTTTTCTTAGTTGTTCTGCT
GATTGGAGTTGTCGCCTTTGGAATATTAAAGAAGAATAACCTTTAAGCACATTCTAGTCC
TTAGATCTTTAAGATGAAGTTATGGATGTAGAATGGAGTCCAAATTGTTCTACCTTATTT
GCTAGTGTTGCTAAAGATGGAAGAATGGAGCTTTGGGATCTCACTAAAAATAATATGTTA
GATCCATTTGCATCAATTATTCCTAAAAACAATGAACCTCCCTTCCCTCCTAAAACAATG
GTAAGATTTGCATAAAGTGCTCCTGTTATTATTACTGGTGATATAGCAGGTGACCTCAAT
GTCTACAGATTACATGGTTATGAAGATTCCGATCCAAAAGTTTAACATGATAGGTTATTA
AAATTACTATATCCTTCCGGATATACAAAAGGAGTCAAAGATACAACCGAAGTAGAGTGA


>TTHERM_00446430(protein)
MDASTLRAGTTRANMQMSSKAGLKSGPTMAGKKLAGGTTRLPQGSKSSKQAGQSKMKTTG
SERDNEYVMEGNVNVTPKRLITQQMKELAQEFQKHEQEQAEKQKKLKQSFKPQTSLLESS
MRSAQQSVDKSSGSENKTSSANIKESSMMDSSRRSEIYSESEEESRLKEEREKKAKKAKQ
LSEDDKEKDVIINLQESETEILLYIPSSLVSSSSVQINQNQIRDENTKNPTAIILERNQK
YEQHCQDIIGSDKFSKRAAQTFKYAPKQQQQQSNRIERAEKGVFAAVWDLYDAQLQEQYN
EYEQLQNEIQKNIDLELKKALKNPFCLLPLDVKSINLHSRAEVPGDTRLLTEKMSSKTYK
PGHTASVNNNTLNPSQDDTGPRDSSFSNLKDVSGTKLKRQFESQNLVTKSYGGNKVHHEQ
MLKQHKETLEILKKEEQKLIEQRLEKVKNQINEEEQKIISSDSLSTYLKYVDRILNQNTY
HKQYILYRNYPEVKIHKRADDEGNKRFNNMRIKRMKQGNNEDEDEEKEKKKEVLEFLFKF
NCDITQDRTVSCADWNPVNKDLLACTYGELDLNVNRQGMVMFWTLKNPSYPERIIKTKSR
LTSCKFSEMNPNLLATGSYDGIVAIYDIRKKGNQPILCNDQTEGKHSDAIWELNWIGKGN
KGNEKGESLVSISSDGRIVEWNMKKELENTELMSLKKTQNPSSKEQANEGTNFRQAAGFS
MDFIRGEYSTYLAATDDGPIHRCSKNYSGQYLESYFGHTGPVYRVRFNPFWSDIFLSCSA
DWSCRLWNIKEEQPLSTFQSLDLQDEVMDVEWSPNCSTLFASVAKDGRMELWDLTKNNML
DPFASIIPKNNEPPFPPKTMVRFAQSAPVIITGDIAGDLNVYRLHGYEDSDPKVQHDRLL
KLLYPSGYTKGVKDTTEVE


>TTHERM_00446430(gene)
ATGGACGCATCAACATTAAGAGCTGGTACAACAAGAGCTAATATGTAAATGAGTTCAAAA
GCTGGACTCAAATCTGGTCCTACTATGGCAGGGTAATTAGCAATTTAAGATAGCAGATTA
TAAGCACATAGCTGAAACCATATTTGATTTTCAAAAAAGAAAAATACTTTAAATTTTGAA
ACTCACAGCTAATTTTTGTTTTTTGTATTGATTTTTGTATGCAGCTGGCATATTAATTAA
CAAACTACTAAATAATATAACAACTACAAAAATATACTAAAAATTCACCTAAAATGCATC
CTAGATGATAAAATTTCTTCTTTTAAAGTAAAAAGCTAGCAGGTGGTACCACTAGGTTGC
CTTAGGGCAGTAAATCGTCCAAGCAAGCAGGATAGTCTAAGATGAAAACTACGGGATCAG
AAAGAGATAATGAATATGTAATGGAGGGTAATGTTAATGTAACTCCTAAAAGGTAAAAAA
TTATTTTAAGACAGATTATTTAAATATAAACTTAAAATTGATTACAAAAAATATTTTTTT
GGCTTTCTAAGCACATTTTTCAAACAAATAGGCTTATAACATAGTAAATGAAAGAATTAG
CTTAAGAGTTTCAAAAGCACGAATAAGAATAAGCTGAAAAATAAAAGAAATTAAAATAGT
CATTTAAACCACAAACTTCATTATTAGAATCCTCGATGAGGAGTGCATAATAGAGCGTTG
TAAGCATTTAAATAATATTTTGGTTTTATTTTAAATAATTAACAATAAATTTGCTTTTTT
TTAGACATATTTTTTAAAAAATAAACGATTTGCAATTATTTTTGAATTACTATTCTATAC
AATTAATAGATTGCTCAAAATTTTTATTTTAATAGGATAAGAGTTCTGGCAGTGAAAACA
AAACAAGTAGCGCAAATATAAAGGAGTCTTCTATGATGGATAGTAGTAGACGTTCCGAAA
TATATTCTGAATCAGAAGAAGAATCTGTAAGCTTGTTTGTTCAATATTTTTAAGATATTT
ACAATTTAATTTCTACCTTTTAATGAATATCTTACAATAAATTTCAAATTTTTTGAGCTT
AGATAAAAAAATAACTATTATTTGATAAGTTAGCCAAAAAATATATAATAGATTTTATGA
ACTAAGTCTAATAGTTCAATACGATTTGAGCAAGTATTTAAATAATTAAATTTATTTTAT
AATAGAGACTTAAAGAGGAGCGTGAAAAGAAGGCAAAAAAGGCTAAATAACTTAGTGAAG
ACGATAAGGAAAAAGATGTCATAATCAATTTATAAGAATCTGAAACAGAGATATTATTAT
ATATGTAATAAACAAATTCAAATCATATGATTAATTAATATTATAAAATAAACAATAAAG
TCCATCTTCATTAGTTTCAAGCTCATCTGTACAAATAAATTAAAACTAAATAAGGGATGA
AAATACCAAAAACCCAACTGCAATTATTTTAGAAAGAAACCAAAAGTATGAATAACATTG
CTAAGATATTATTGGCAGTGATAAGTTTTCTAAGAGAGCTGCTTAAACATTTAAGTATGC
TCCTAAGTAACAGTAATAGTAATCTAATAGAATTGAAAGAGCTGAGAAAGGTGTGTTTGC
AGCTGTTTGGGATTTGTATGATGCATAACTATAAGAATAGTACAACGAATATGAATAACT
ATAAAATGAAATATAAAAAAATATTGATTTAGAGTTAAAGAAAGCTCTAAAAAATCCATT
TTGCTTACTTCCTCTTGATGTTAAATCTATCAACTTACACTCTAGAGCTGAAGTACCTGG
TGATACTCGTCTTTTGACTGAGAAAATGAGCAGTAAAACCTACAAGCCAGGACATACTGC
TTCAGTAAATAATAATACACTTAATCCTTCATAAGATGATACAGGACCTCGTGATTCTTC
TTTCTCAAATTTGAAAGAGTATTTAATTTAATTTAAATAAAAAATTTATAATAATAAAAT
ATTTAAAGCGTTTCAGGCACTAAACTAAAGAGACAGTTTGAAAGCTAAAATTTAGTGACA
AAATCTTATGGTGGTAATAAGGTTCATCATGAGTAAATGCTTAAGTAACATAAAGAAACA
TTAGAAATTTTAAAGAAAGAAGAATAAAAGCTGATTGAATAAAGACTTGAAAAAGTTAAA
AATTAGATAAGTAAATTTAATCCTTATTAAGTTGTTTCTTACTTTTAATTAAATTATCAA
TTTTAAAATAAAAAGATGAGGAAGAACAAAAGATCATTTCTAGTGATTCTTTATCGACAT
ATTTAAAATATGTTGATAGAATTCTCAATCAAAATACTTATCATAAGTAATACATTTTGT
ATAGAAATTATCCTGAAGTCAAGATTCACAAAAGAGCTGATGATGAGGGTAACAAAAGAT
TCAACAATATGCGTATCAAGAGAATGAAGTAAGGTAATAATGAAGATGAAGATGAAGAAA
AAGAAAAGAAAAAAGAAGTTTTAGAGTTCCTTTTCAAATTTAATTGTGATATCACTTAGG
ATAGAACTGTAAGTTGTGCAGATTGGAATCCAGTTAATAAAGATTTATTGGCTTGTACTT
ACGGTGAACTTGATTTGAATGTTAACAGACAAGGTATGGTTATGTTTTGGACACTTAAGA
ACCCTAGCTATCCTGAAAGAATTATCAAAACTAAATCACGTAAATTTTTTAATAAATAAA
AATCTTACAGTGCAAATAAAATTTTAAAATATATTTTAGGTTTAACTAGTTGTAAATTTT
CTGAGATGAATCCTAATTTACTTGCTACAGGAAGTTATGATGGTATAGTAGCAATTTATG
ATATAAGAAAGAAGGGTAATCAACCAATCCTTTGTAACGATTAAACCGAAGGTAAGCATA
GTGATGCCATTTGGGAGTTAAATTGGATTGGTAAAGGAAACAAAGGTAACGAAAAGGGAG
AAAGCTTAGTCAGTATCAGCTCTGATGGTAAAAATTCAAAGATTTTTTCATCATTTAAGC
TTTATTTTCATTTTCTTTTAATAAAATAAAAAATGAATAAAATAAAAAATATTTTTTATT
GCTTAAAATTAATATTTAAATAATTTCAAATATGGTTTGATAATAATTTTAAAATACAAA
AAGGTCGTATTGTTGAATGGAACATGAAGAAAGAATTAGAAAATACAGAATTAATGAGCC
TTAAAAAGACATAAAATCCTTCTAGCAAAGAACAAGCAAATGAAGGAACTAATTTTAGAT
AGGCAGCTGGTTTTTCTATGGACTTCATTAGGGGAGAATACTCTACTTACTTAGCTGCAA
CTGATGATGGACCTATTCATAGATGCTCTAAAAATTATTCTGGACAATATCTAGAATCGT
ACTTCGGACATACAGGACCTGTATATAGAGTTCGTTTCAATCCTTTTTGGTCAGACATTT
TTCTTAGTTGTTCTGCTGATTGGAGTTGTCGCCTTTGGAATATTAAAGAAGAATAACCTT
TAAGCACATTCTAGGTAAATAAAACTTTAAGTTACAAATTTTAAAAAAAATAAAAAATAA
AAAAAAGTCCTTAGATCTTTAAGATGAAGTTATGGATGTAGAATGGAGTCCAAATTGTTC
TACCTTATTTGCTAGTGTTGCTAAAGATGGAAGAATGGAGCTTTGGGATCTCACTAAAAA
TAATATGTTAGATCCATTTGCATCAATTATTCCTAAAAACAATGAACCTCCCTTCCCTCC
TAAAACAATGGTAAGATTTGCATAAAGTGCTCCTGTTATTATTACTGGTGATATAGCAGG
TGACCTCAATGTCTACAGATTACATGGTAAATTATCTTTTAAAAAATCTAATAGCTTAAA
TTTAATTCATTTTTATTATAGGTTATGAAGATTCCGATCCAAAAGTTTAACATGATAGGT
TATTAAAATTACTATATCCTTCCGGATATACAAAAGGAGTCAAAGATACAACCGAAGTAG
AGTGA