Identifiers and Description

Gene Model Identifier

TTHERM_00196380

Standard Name

IC5

Aliases

PreTt06823 | 16.m00479 | IC140

Description

Intermediate chain subunit of ciliary two-headed inner arm dynein (IAD) complex 1

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

  • ( PF00400 ) WD domain, G-beta repeat
  • ( PF08674 ) Acetylcholinesterase tetramerisation domain
  • ( TIGR01918 ) selenoprotein B, glycine/betaine/sarcosine/D-proline reductase family

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00196380

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_03809.19.997093137033517e-262hypothetical protein (717 aa)
OxytrichaContig2453.0.g792.9990837046884738e-127WD domain, G-beta repeat
Stentor CoeruleusSteCoe_312467.095474162284704e-23

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:16933976: Eisen JA, Coyne RS, Wu M, Wu D, Thiagarajan M, Wortman JR, Badger JH, Ren Q, Amedeo P, Jones KM, Tallon LJ, Delcher AL, Salzberg SL, Silva JC, Haas BJ, Majoros WH, Farzad M, Carlton JM, Smith RK, Garg J, Pearlman RE, Karrer KM, Sun L, Manning G, Elde NC, Turkewitz AP, Asai DJ, Wilkes DE, Wang Y, Cai H, Collins K, Stewart BA, Lee SR, Wilamowska K, Weinberg Z, Ruzzo WL, Wloga D, Gaertig J, Frankel J, Tsao CC, Gorovsky MA, Keeling PJ, Waller RF, Patron NJ, Cherry JM, Stover NA,

Sequences

>TTHERM_00196380(coding)
ATGAAATTAAGCAAGAGAGACGAAAGCTCATCAGACCCAAGTGATGAAGAAAATAAAGTA
GAACGTAATCGCTATTGGAGATTCTGGTAGTCTTAGTTTGAAGAAACAGTAAAGGAGATA
TAATTGTCTATGATAAAGAAAAATAGACCAACCATAAAAATGCAATTCATTAAGAAAAGA
AGAGAGTTTGGATAACCATGTAAATTAAATGAAACTGATGCAAGTGAAAAAATGTTGGAA
GTAAAACAGCAAAGTGATCCATTTGCTCATGTCCGTAATAAAGTTATTGATATAGGTTTA
TAAGGTTGTAATCCAATAGTAAATTCTTCCACTTAAACAATCTGGAATAGGCGTATAAAT
AAAGCTCTCACTGTAGATAATGAATAAACAATTGTAGAAATAGAAGATGATAACTAAGAG
CTTCTCAAATTTTTAGATAATGTGTATCCCTTGATGGAAGAAGCGTTACAATCAAATGAA
ACTATTGATATTTATCAAAACGATTTTGAGTTATTTGATGCCGATGATGTAGCTGCAGAA
GGCACTGAACTTTCTAATGCAATTAAAGAATGGAAAACATTTTACTATTTATAATGCAAA
GGCAAGAAAATATCTTGTATTCAATTCCAACCTAATAACCAGCTCAATTAAAAAGGAAAA
TATATTGCAGCTGCATTTATGGAAAATCTAACTTTTGAGGAAAGAGTAATTTATAGTATG
AAATCTCATAAATTTATGATTGTATTTTGGGATTATGATGACTAACATTCAATTGATCCT
GTTCTTATTCTCACAAGTCCTTTAGAAATAATAACTTTCTAATTTAATCCTAAAGATCCA
AATATAGTCATCGGTGGTGCTGCAAATGGTTAAATTATCATGTGGGATTTGAAATAAAGT
AACAGTCTTTACACTGTAACAGGTAAAAAAGGGTAGAAAGCTAAATAAGACAGTAAAAGT
GAAATTCCTGAAATAAATCCTTTGATTCTTTCTCAGCTTCAAGATCCTTCAAGTGCCTAG
TAACTACCAAATAATGAAATAGTCCGCAAAAATGTTTGCTCCCATAAAAATCCAGTTCTT
TCAATTTCTTGGATTCCTCCTACAGTAGAATTTGATAGAAAAGTATTTAATAATGTTGTT
CATCCCACTCATGGAGATTGTTACTAATTTGCATCTATTTCTTGGGATGGCCAAGTTTGT
TTTTGGGATACAAGATTTAATGATTAAAAAGACTCTAAGAAATAATTTGATATTACCAGT
CATCAATGGAAAGCAAATTACGGTTTGCAACTTGTTAGACCTGAAGGTGGAGGTACAATG
GGTGGTGCACAAATTGCATTTAGAAAAGGTTAAAGAAATCCTACATTCACAGGAACATCT
GATGAAGGTGAACTTTTCTTGGTTGATTGGACAGTTCACCCAACAGAAGATAGTAACAGA
AATGACAAAGTAACTAAATTATGGTAAAATGAAAGATCTTATCGTCCTACAGTTGCCTTA
GAAAATTCTCCCTTTTATGATGATATAATTCTTACTATCCATGATTTCAATTTCTGTATC
TGGAAGCATGATGTTGATGTACCAATTTTTGATTCTGCTATAGTTAAATAAGGATAAATT
ACATGTGGTGCTTTTTCACCTTCACGTCCTGGTGTTGTAATCATTGGACTTAATGATGGT
AATATAAATGTTTGGGATTTCCTCGACTAATCTCATAAAGCAACTCTTACATATCACGTT
GGTGCTAAACCTCTCTCATATATTAAATTCCATGAAAATCAACATCATTCATTAGCAGTT
GGTGATTATGATGGTACTGTACATATTTTAGAATTACCATATACCTTATGGAAAAAGATA
GGAGAAGAAGAAAAAACCATGAACGATTTTTGGAATCGTGAAGTTTTAAGAGTTAGATAC
TTTAAACATAGATTTGAAATTAGAGAAGAAGAATTTAAAAAATTAAAAGAAAAGAAAGAT
TAAGAAGTTGCTGAAGAAGTAACTACAACCTAAAAAGTCGATAACTAAGTAGATGAAGAC
GAAGAATTAGAAAAAGAATATTAAGAATAAGCTCTTTAATATATTAATGAAGTTATAAAA
GGAGTCAAGCCAGATTAAGAAGCACCTTAAAACTCTAAAGCTGCTAAAAAATGA


>TTHERM_00196380(protein)
MKLSKRDESSSDPSDEENKVERNRYWRFWQSQFEETVKEIQLSMIKKNRPTIKMQFIKKR
REFGQPCKLNETDASEKMLEVKQQSDPFAHVRNKVIDIGLQGCNPIVNSSTQTIWNRRIN
KALTVDNEQTIVEIEDDNQELLKFLDNVYPLMEEALQSNETIDIYQNDFELFDADDVAAE
GTELSNAIKEWKTFYYLQCKGKKISCIQFQPNNQLNQKGKYIAAAFMENLTFEERVIYSM
KSHKFMIVFWDYDDQHSIDPVLILTSPLEIITFQFNPKDPNIVIGGAANGQIIMWDLKQS
NSLYTVTGKKGQKAKQDSKSEIPEINPLILSQLQDPSSAQQLPNNEIVRKNVCSHKNPVL
SISWIPPTVEFDRKVFNNVVHPTHGDCYQFASISWDGQVCFWDTRFNDQKDSKKQFDITS
HQWKANYGLQLVRPEGGGTMGGAQIAFRKGQRNPTFTGTSDEGELFLVDWTVHPTEDSNR
NDKVTKLWQNERSYRPTVALENSPFYDDIILTIHDFNFCIWKHDVDVPIFDSAIVKQGQI
TCGAFSPSRPGVVIIGLNDGNINVWDFLDQSHKATLTYHVGAKPLSYIKFHENQHHSLAV
GDYDGTVHILELPYTLWKKIGEEEKTMNDFWNREVLRVRYFKHRFEIREEEFKKLKEKKD
QEVAEEVTTTQKVDNQVDEDEELEKEYQEQALQYINEVIKGVKPDQEAPQNSKAAKK


>TTHERM_00196380(gene)
ATGAAATTAAGCAAGAGAGACGAAAGCTCATCAGGTATTCATTACAAATATGATATGGCT
AAATTTAATACGCATTAGATATATTATTACCCAATTAAGTCCTTTACAGAAATAGCATTT
GTTTTTTTATGAAAGTTTATTTTAAGCTTCATAAATATTCAATATGATCATTATTATCAT
ATGAATTTAAATATATAAAGAAGGTATCTATCTAGCTTTTACAAGATATAAAATTAGATG
CATAGCCATAATAATATGAGATATTTTTTTAAATAGTGAAATTAATGTCTTGGTATTTAA
ATTTACATTCTAATTTAAAATAGACCCAAGTGATGAAGAAAATAAAGTAGAACGTAATCG
CTATTGGAGATTCTGGTAGTCTTAGTTTGAAGAAACAGTAAAGGAGATATAATTGTCTAT
GATAAAGAAAAATAGACCAACCATAAAAATGCAATTCATTAAGAAAAGAAGAGAGTTTGG
ATAACCATGTAAATTAAATGAAACTGATGCAAGTGAAAAAATGTTGGAAGTAAAACAGCA
AAGTGATCCATTTGCTCATGTCCGTAATAAAGTTATTGATATAGGTTTATAAGGTTGTAA
TCCAATAGTAAATTCTTCCACTTAAACAATCTGGAATAGGCGTATAAATAAAGCTCTCAC
TGTAGATAATGAATAAACAATTGTAGAAATAGAAGATGATAACTAAGAGCTTCTCAAATT
TTTAGATAATGTGTATCCCTTGATGGAAGAAGCGTTACAATCAAATGAAACTATTGATAT
TTATCAAAACGATTTTGAGTTATTTGATGCCGATGATGTAGCTGCAGAAGGCACTGAACT
TTCTAATGCAATTAAAGAATGGAAAACATTTTACTATTTATAATGCAAAGGCAAGAAAAT
ATCTTGTATTCAATTCCAACCTAATAACCAGCTCAATTAAAAGTAGGAAATAACTGCAAT
TTTTAAATATAAAAATTGATTTAATTTATTTGCATAAAAATGCATTTTGAAATTTAAAAA
AAGATATTACATTATTTCTTTTAATGAAATAGCAAAAATTATAAAAATTTAATGTTATAA
AATGATTAAAAAACTAAGAAAAGCTATTTTAAATTTAAATTAAATCTTATTTATGACTTT
TCTTTCATTTTAAATAAAAGAGGAAAATATATTGCAGCTGCATTTATGGAAAATCTAACT
TTTGAGGAAAGAGTAATTTATAGTATGAAATCTCATAAATTTATGATTGTATTTTGGGAT
TATGATGACTAACATTCAATTGATCCTGTTCTTATTCTCACAAGTCCTTTAGAAATAATA
ACTTTCTAATTTAATCCTAAAGATCCAAATATAGTCATCGGTAAATAAAACTATTCTAAA
AATGCAATTTTTATCTTAAATATAAATTAATAATATAGGTGGTGCTGCAAATGGTTAAAT
TATCATGTGGGATTTGAAATAAAGTAACAGTCTTTACACTGTAACAGGTAAAAAAGGGTA
GAAAGCTAAATAAGACAGTAAAAGTGAAATTCCTGAAATAAATCCTTTGATTCTTTCTCA
GCTTCAAGATCCTTCAAGTGCCTAGTAACTACCAAATAATGAAATAGTCCGCAAAAATGT
TTGCTCCCATAAAAATCCAGTTCTTTCAATTTCTTGGATTCCTCCTACAGTAGAATTTGA
TAGAAAAGTATTTAATAATGTTGTTCATCCCACTCGTAAATAAAATTTCAATTTTCATTA
AGGCTCTATTAAATTATTATCTATTTATTTATTTTAGATGGAGATTGTTACTAATTTGCA
TCTATTTCTTGGGATGGCCAAGTTTGTTTTTGGGATACAAGATTTAATGATTAAAAAGAC
TCTAAGAAATAATTTGATGTAATTTAGCTACTTATGATGAAATTTAAATTTAAAATTATT
TTTTTTATTTATTTATTTAGATTACCAGTCATCAATGGAAAGCAAATTACGGTTTGCAAC
TTGTTAGACCTGAAGGTGGAGGTACAATGGGTGGTGCACAAATTGCATTTAGAAAAGGTT
AAAGAAATCCTACATTCACAGGAACATCTGATGAAGGTGAACTTTTCTTGGTTGATTGGA
CAGTTCACCCAACAGAAGATAGTAACAGAAATGACAAAGTAACTAAATTATGGTAAAATG
AAAGATCTTATCGTCCTACAGTTGCCTTAGAAAATTCTCCCTTTTATGATGATATAATTC
TTACTATCCATGATTTCAATTTCTGTATCTGGAAGCATGATGTTGATGTACCAATTTTTG
ATTCTGCTATAGTTAAATAAGGATAAATTACATGTGGTGCTTTTTCACCTTCACGTCCTG
GTGTTGTAATCATTGGACTTAATGATGGTAATATAAATGTTTGGGATTTCCTCGACTAAT
CTCATAAAGCAACTCTTACATATCACGTTGGTGCTAAACCTCTCTCATATATTAAATTCC
ATGAAAATCAACATCATTCATTAGTATATATTTTTATTATAATAAGCTTTTTAATTATTT
ATTTATTTTTGCTTTAACTTTTAAACAGGCAGTTGGTGATTATGATGGTACTGTACATAT
TTTAGAATTACCATATACCTTATGGAAAAAGATAGGAGAAGAAGAAAAAACCATGAACGA
TTTTTGGAATCGTGAAGTTTTAAGAGTTAGATACTTTAAACATAGATTTGAAATTAGAGA
AGAAGAATTTAAAAAATTAAAAGAAAAGAAAGATTAAGAAGTTGCTGAAGAAGTAACTAC
AACCTAAAAAGTCGTAATAAAGCTCTATTTCTCATATTTAACTAAATACTTAAATTTACC
TAAATATAGGATAACTAAGTAGATGAAGACGAAGAATTAGAAAAAGAATATTAAGAATAA
GCTCTTTAATATATTAATGAAGTTATAAAAGGAGTCAAGCCAGATTAAGAAGCACCTTAA
AACTCTAAAGCTGCTAAAAAATGA