Identifiers and Description

Gene Model Identifier

TTHERM_00773750

Standard Name

IC4

Aliases

PreTt04466 | 128.m00144 | 3676.m00069 | IC74

Description

Intermediate chain subunit of non-axonemal dynein complex 1

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

  • ( PF00400 ) WD domain, G-beta repeat
  • ( PF04394 ) Protein of unknown function, DUF536

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00773750

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_17701.19.997093137033517e-262hypothetical protein (600 aa)
OxytrichaContig3701.0.g571.9992560499818233e-109WD domain, G-beta repeat
DictyBaseDDB_G02808499.997329401607134e-86dicA on chromosome: 3 position
3856978 to 3859184
WormBaseWBGene000159274.0015855602347305e-61locus:dyci-1 status:Confirme
d UniProt:O45087 protein_i
d:CCD64991.1
Stentor CoeruleusSteCoe_140543.720075976020836e-44
SGDYDL195W0.0000000006999585478469937SEC31 Component of the Sec13p-
Sec31p complex of the COPII ve
sicle coat, required for vesic
le formation in ER to Golgi tr
ansport; mutant has increased
aneuploidy tolerance

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:16933976: Eisen JA, Coyne RS, Wu M, Wu D, Thiagarajan M, Wortman JR, Badger JH, Ren Q, Amedeo P, Jones KM, Tallon LJ, Delcher AL, Salzberg SL, Silva JC, Haas BJ, Majoros WH, Farzad M, Carlton JM, Smith RK, Garg J, Pearlman RE, Karrer KM, Sun L, Manning G, Elde NC, Turkewitz AP, Asai DJ, Wilkes DE, Wang Y, Cai H, Collins K, Stewart BA, Lee SR, Wilamowska K, Weinberg Z, Ruzzo WL, Wloga D, Gaertig J, Frankel J, Tsao CC, Gorovsky MA, Keeling PJ, Waller RF, Patron NJ, Cherry JM, Stover NA,

Sequences

>TTHERM_00773750(coding)
ATGAGCAAAAATATTGAAGACTACAAAAAAAAGCTTGAGGAATTAAAAAAAGGTAGAGCA
GCTGCTAGAACAACTGAATAAATAGTAGGAAATGTTTAGACTAGCTAGTAACCTGTTTAA
AATATAGATAAAGAAGAATAAAAGGAAAGCTAGTAAACAAGTTAGAGTCATTTAGATAAT
ATTTCTAATTAACATTAAGAAGCAAGTAGCTCATCCTAAAAGAAACTTAGGACTTTCAAT
TTAGAAATGGATAAATAAGTTATAGAAATTAGCATTCCTCCTAAAGAAAAAATTCATTAT
GAAAGAGAAATTTAATGCGATTTAGAAGTAGAACAACAAACTCATAAACTTTTCCATGGA
ACTGGAAATGAATCAGAAAGCAATTTCCAACATGTTTAAGTGGAAATTGAAAACCCCGAT
GTATTCTAAAATCCTCATCAAGTTTCTTCTTAAATAGCTGCCTCAGCTCATAAAGCATTA
CAATAACCTGTCCTACCTTCTAAAGTTGAATTAACAGGAGAAGACATAAGTCATATTGTA
AAATCTAAAAATTTCCTAGATTTTTTTAATAGAAGTTCTAGATTAATAGAAAAAGCAATT
ACTAACAAAGACGACAGCAATCTCTATGCTTTAATTGATGTTATTGGAGATAAAAGCAAT
TCAAATTTACAATAAACAGGTATCAAAAGTTATTTATAACACTCAGTCAAACTTACTGAT
CAGTAATATGGTACCAACAGAGTAGTTACTGGTATTGAGTGGTCTCCTCATAGAAATGAT
TTAGTTCTAGCTTCTTATTCCCAAAATGAATAAGGAAATATAAATGATCCTGTTGGGTTA
GTTGCTTTGTGGTCTTTATCTTTAAAGACAAGACCTGAATTCTACTGCTTCAGTTAGTCT
TAAGTTACTTGTGTCAAATATAATCCATTTTAAGAAAATCTCGTACTTGGTGGACTTTAT
AATGGCTAAATAGTTTTATGGGATTTAAGAGCTAAGAGTACACCTATACAGAGAACTACA
TTCACAACTGGTCATTCTTATCCTATATACTCTTTAGATGTAGTCGGTTCTGTAAATGCA
CATAATATTATTTCTATTTCAAATGATGGTAAACTTTGCGTTTGGAATATGAACATGCTT
ACTTAGCCTTCTAAAACTATTGACTAATTAACTTATACTCCTCCTGAGAAAACAAAATAG
GATATAAATGTTACTTGTATGCAATTTCCTTAAGGAGATGCTAATAATTTTTACATAGGT
TCTGAAGATGGTTCATTCTATAGAACCTAGTTACACTCTAAGACATAAAATAATAGTCAA
AGCATGGTAGCAGCTGTTCATGCTCATGATGCACCTATCTCTTCATTGAGCATTAGTCAT
GATCCAACTGGCTCTCATTAACTTTCTGGTATGGTTTTAACTTCATCTTTTGATTGGACA
GTAAAATTATGGAATCCTAAAGTCAGTGGAAAACCTAAAAAAGTACTTACATTTGATTGC
TCTGAAGATTATGTCTATGATGTTGCCTGGAATCCTGTTAATCCTTCACTATTTTGTTGT
GTTGATGGCGAAGGATACTTAGATGTCTGGGATTTATGTGAAGATATCGAAAATCCAGTT
TACCATGAATAAGAAGATAAATTTGCTCTAAACAAGTGCAGATGGAGTTTAGATGGTTCA
AAGGTAGCAACAGGTGACTCAAGAGGCAATCTTAGCATTTATAATTTGGATAAAAAATAC
CTAAAAATAAATGAAAATAAATTAAGCAATATAATTGATTTATATGAAAATAAATAATGA


>TTHERM_00773750(protein)
MSKNIEDYKKKLEELKKGRAAARTTEQIVGNVQTSQQPVQNIDKEEQKESQQTSQSHLDN
ISNQHQEASSSSQKKLRTFNLEMDKQVIEISIPPKEKIHYEREIQCDLEVEQQTHKLFHG
TGNESESNFQHVQVEIENPDVFQNPHQVSSQIAASAHKALQQPVLPSKVELTGEDISHIV
KSKNFLDFFNRSSRLIEKAITNKDDSNLYALIDVIGDKSNSNLQQTGIKSYLQHSVKLTD
QQYGTNRVVTGIEWSPHRNDLVLASYSQNEQGNINDPVGLVALWSLSLKTRPEFYCFSQS
QVTCVKYNPFQENLVLGGLYNGQIVLWDLRAKSTPIQRTTFTTGHSYPIYSLDVVGSVNA
HNIISISNDGKLCVWNMNMLTQPSKTIDQLTYTPPEKTKQDINVTCMQFPQGDANNFYIG
SEDGSFYRTQLHSKTQNNSQSMVAAVHAHDAPISSLSISHDPTGSHQLSGMVLTSSFDWT
VKLWNPKVSGKPKKVLTFDCSEDYVYDVAWNPVNPSLFCCVDGEGYLDVWDLCEDIENPV
YHEQEDKFALNKCRWSLDGSKVATGDSRGNLSIYNLDKKYLKINENKLSNIIDLYENKQ


>TTHERM_00773750(gene)
ATGAGCAAAAATATTGAAGACTACAAAAAAAAGCTTGAGGAGTAAACATATTTTTTAGAT
TTTCTAAATGTTATTTAGGTTTAGTTATTTTATGAGAATATGTGAGGGAAATAGGCTTAG
ATATAATTTGAAATAAATAAATGCAAAAATTAAAATTAGAAATAGTATCTTAAAATTAAA
TTATTTTTGTATAATAGATTAAAAAAAGGTAGAGCAGCTGCTAGAACAACTGAATAAATA
GTAGGAAATGTTTAGACTAGCTAGTAACCTGTTTAAAATATAGATAAAGAAGAATAAAAG
GAAAGCTAGTAAACAAGTTAGAGTCATTTAGATAATATTTCTAATTAACATTAAGAAGCA
AGTAGCTCATCCTAAAAGAAACTTAGGACTTTCAATTTAGAAATGGATAAATAAGTTATA
GAAATTAGCATTCCTCCTAAAGTATTTCCTATTTTGACTTAAAACAAGAATACATTATTC
AAATTTAATATTTCTTCCTTAAATCATATGATAGGAAAAAATTCATTATGAAAGAGAAAT
TTAATGCGATTTAGAAGTAGAACAACAAACTCATAAACTTTTCCATGGAACTGGAAATGA
ATCAGAAAGCAATTTCCAACATGTTTAAGTGGAAATTGAAAACCCCGATGTATTCTAAAA
TCCTCATCAAGTTTCTTCTTAAATAGCTGCCTCAGCTCATAAAGCATTACAATAACCTGT
CCTACCTTCTAAAGGTATTACAAAAATATAATTAGACTCAATAAATTATCTGAAAATATT
TTGATGTGTAAATATAAAAAGTTGAATTAACAGGAGAAGACATAAGTCATATTGTAAAAT
CTAAAAATTTCCTAGATTTTTTTAATAGAAGTTCTAGATTAATAGAAAAAGTAAATTTTT
AATAAAAATATATTTTAAATCAATAAAAAATTTATTTATAAATTAATTAATTAATAATTA
ATTTAAATTTGGAGCTAAAATTTATATAAATTAACATAGGCAATTACTAACAAAGACGAC
AGCAATCTCTATGCTTTAATTGATGTTATTGGAGATAAAAGCAATTCAAATTTACAATAG
TAAAATTTAATTTAAAAAACAAGCATTTTACTTACAATTAAACATTTTTAAAGAACAGGT
ATCAAAAGTTATTTATAACACTCAGTCAAACTTACTGATCAGTAATATGGTACCAACAGA
GTAGTTACTGGTATTGAGTGGTCTCCTCATGTAATTTCATTACATTTTAATTTTTTTTTC
TAACTTAAATAATAAATTTTTTAATGAATTTTTATTATTTTAGAGAAATGATTTAGTTCT
AGCTTCTTATTCCCAAAATGAATAAGGAAATATAAATGATCCTGTTGGGTTAGTTGCTTT
GTGGTCTTTATCTTTAAAGACAAGACCTGAATTCTACTGCTTCAGTTAGGTATAAAAAAT
ACTACTATCTATTTATTTTTTTAAAATAATTTTAAATAAAATTTAGTCTTAAGTTACTTG
TGTCAAATATAATCCATTTTAAGAAAATCTCGTACTTGGTGGACTTTATAATGGCTAAAT
AGTTTTATGGGATTTAAGAGCTAAGAGTACACCTATACAGAGAACTACATTCACAACTGG
TCATTCTTATCCTATATACTCTTTAGATGTAGTCGGTTCTGTAAATGCACATAATATTAT
TTCTATTTCAAATGATGGTAAACTTTGCGTTTGGAATATGAACATGCTTACTTAGCCTTC
TAAAACTATTGACTAATTAACTTATACTCCTCCTGAGAAAACAAAATAGGATATAAATGT
TACTTGTATGCAATTTCCTTAAGGAGATGCTAATAATTTTTACATAGGTTCTGAAGATGG
TTCATTCTATAGAACCTAGTTACACTCTAAGACGTAAATACTATTTTTCAACAATTTTTT
TTAATTTTATATTCAGATAAAATAATAGTCAAAGCATGGTAGCAGCTGTTCATGCTCATG
ATGCACCTATCTCTTCATTGAGCATTAGTCATGATCCAACTGGCTCTCATTAAGTAAATT
TCAAATATCTATAATAAATTTATTAAAATAAAATTTTTTTCTTTTCAAATTAAAGCTTTC
TGGTATGGTTTTAACTTCATCTTTTGATTGGACAGTAAAATTATGGAATCCTAAAGTCAG
TGGAAAACCTAAAAAAGTACTTACATTTGATTGCTCTGAAGATTATGTCTATGATGTTGC
CTGGAATCCTGTATTCATATTATAAATTTATTAATAAAAATATTTATATTATTCATTTAA
TTAGGTTAATCCTTCACTATTTTGTTGTGTTGATGGCGAAGGATACTTAGATGTCTGGGA
TTTATGTGAAGATATCGAAAATCCAGTTTACCATGAATAAGAAGGTATAATTAATTATAA
TATAAATTTACTTTATAAATATTATTTAAAATAGATAAATTTGCTCTAAACAAGTGCAGA
TGGAGTTTAGATGGTTCAAAGGTAGCAACAGGTGACTCAAGAGGCAATCTTAGCATTTAT
AATTTGGATAAAAAAGTAATTATTTATTTCATTATTCATTATTCATTTTAAATTATAAAA
ACACAATAATTAAAAACTTATTTTAAAAAATAGTACCTAAAAATAAATGAAAATAAATTA
AGCAATATAATTGATTTATATGAAAATAAATAATGA