Identifiers and Description

Gene Model Identifier

TTHERM_00487150

Standard Name

IC2

Aliases

PreTt19646 | 59.m00284 | 3680.m00141 | IC78

Description

Intermediate chain subunit of ciliary three-headed outer arm dynein (OAD)"

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

  • ( PF00400 ) WD domain, G-beta repeat

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 11.4%

TetraMine Data

TTHERM_00487150

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Stentor CoeruleusSteCoe_280570
Tetrahymena borealisEI9_12221.19.997093137033517e-262hypothetical protein (668 aa)
OxytrichaContig16948.0.0.g289.997093137033517e-262WD domain, G-beta repeat
DictyBaseDDB_G02808495.999781043483669e-32dicA on chromosome: 3 position
3856978 to 3859184
WormBaseWBGene000159272.000620012690291e-23locus:dyci-1 status:Confirme
d UniProt:O45087 protein_i
d:CCD64991.1
SGDYDR364C0.0000029996948234116693CDC40 Pre-mRNA splicing factor
, important for catalytic step
II of pre-mRNA splicing and p
lays a role in cell cycle prog
ression; required for DNA synt
hesis during mitosis and meios
is; has WD repeats

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:16933976: Eisen JA, Coyne RS, Wu M, Wu D, Thiagarajan M, Wortman JR, Badger JH, Ren Q, Amedeo P, Jones KM, Tallon LJ, Delcher AL, Salzberg SL, Silva JC, Haas BJ, Majoros WH, Farzad M, Carlton JM, Smith RK, Garg J, Pearlman RE, Karrer KM, Sun L, Manning G, Elde NC, Turkewitz AP, Asai DJ, Wilkes DE, Wang Y, Cai H, Collins K, Stewart BA, Lee SR, Wilamowska K, Weinberg Z, Ruzzo WL, Wloga D, Gaertig J, Frankel J, Tsao CC, Gorovsky MA, Keeling PJ, Waller RF, Patron NJ, Cherry JM, Stover NA,
  2. Ref:9399595: Ikawa Y, Okada A, Imahori H, Shiraishi H, Inoue T (1997) Identification of the nucleotides in the A-rich bulge of the Tetrahymena ribozyme responsible for an efficient self-splicing reaction. Journal of biochemistry 122(4):878-82

Sequences

>TTHERM_00487150(coding)
ATGCCTCCAAAATAAACAAAAGTTGTAGCCAGCCGTAAGACTGTTATGCCTATTAGTAGA
GCAGGCAGAGCTTAAATCCGTAGAAAGGATTCTAACACTCAAAATAATATGAATGACTAA
GGTATGGAAGATGAGGAAATCGATCAACAAAGAGAGGGAATGAAGAACCAATACGAACAA
TTAACTGCCCAAGAATTAAATGAAGATATGCCTTCAAAAATGTTAGAGCCAAAGAACCCT
CAAGCTCCTAAAAATATCACTGTTTATGACTATTATACTCGTAAATTTAAGACTGATGAG
TTAGTCGATTAAATGATTGTTCATTTTTCTATGGATGGTGATTATATTTGGAAGGAATCA
AATGAATACAAAACTTAAGAAGAAATTCGTGATACAAAGAAAGCTTTGATCAAGGAAGCA
ATGCGTAAATAAGAAAGTGAAGAACCTGGTGCAAACCATGATGAAGAAGCAATTAAATAA
ACTCTAAGAAACAAATTTAATTACAATACACGTGAATGTTAAACAATTAATCCTTCAATA
AGAGAGCGTGGAGTTTCTACCGAACCTCCACCATCTGATACAATCTGTGGCAATATTACT
CAATGGGAAATTTTTGATGCTTATTATGCAGAAATTATGAAGGACCATCAAATTGAAAAT
AAAAAGAAGAAAGAGGTTGATTAGGATAAGAAGCAAGATTAATCTATGTACTCAACTTCG
TTCAAAAGATGTTGCAAAATTATGGAACGTATGGTTGTATAAAACGATTAGGAAGATAAG
TATCATGATTATCGTTATTATTGGAGTTAAGGCGACAACCTAGAAGCTGGTAAAAATGAA
GGTCATTTATTACCTATTTGGAGATTTAGTAATGAAAAGCAAAGAAAGAAAAATGTTACT
AGTATTTGTTGGAACCCATTATATCCAGATTTATTCGCAGTTAGTTTGGGTAGTTATGAC
TTTACTAAATAGCGTATGGGTTTAATTTGCTTATATTCTTTAAAAAACACCACACATCCA
GAATATGCCTTCAACTGTGAAGCTGGTGTTATGTGTTTAGATTTCCATCCTAAAAGTGCT
GCCCTTCTTGCTGTCGGTTTGTATGATGGTACTGTGTTAGTTTACGATATCCGTAACAAA
CACAAGAAACCTATTTATTAATCAACTGTACGTAATTAAAAGCACACAGATCCTGTCTGG
CAAGTTAAATGGAATCCAGATACTTCCAAAAATTATAATTTTTATTCCATTTCTAGTGAT
GGTAGAGTCATGAATTGGATTCTTATGAAAAATAAGTTAGAACCTGAAGAAGTTATTTTA
CTTCGTCTTGTAGGTAAGAATGAAGAGGAATCAACTTTAATCGGTTTAGCTTGTGGTCTC
TGCTTTGATTTCAATAAATTTGAACCTCATATCTTCCTTGTAGGTACAGAAGAAGGTAAA
ATTCATAAGTGTTCTCGTGCTTACTCTGGCTAGTATTAAGAAACCTACAACGGCCATCTT
CTTGCCGTCTACAAAGTTAAGTGGAATAACTTCCATCCTAGAACTTTCATTTCTGCTTCT
GCTGATTGGACTGTAAGAATTTGGGATAGTAAATACACTTCATAGATTATTTGTTTTGAT
TTATCTATGATGGTAGTCGATGCTGTCTGGGCTCCTTACTCATCAACTGTCTTTGCATGT
GCTACTATGGACAAAGTTCAAGTTTATGATTTGAACGTAGATAAACTCAATAAATTGGCA
GAACAAAAGATTGTTAAATAACCTAAGTTAACTAACTTGTCTTTCAATTATAAAGATCCT
ATCTTGTTAGTTGGTGATTCTCACGGTGGTGTTACTCTTGTCAAGCTCTCCCCTAATCTT
TGCAAAAGTGGACCTGAAATTAAATAAACTGAAGATAAAAAAGCAATGGAAGAATTTAAA
AATGTAAAAATAGAGGATTACGAAAGAGAAAAGATGGAAAATCTTCTCGCTGTAGTTAGT
AAATGGGAAAGGGAAGATGCTTGA


>TTHERM_00487150(protein)
MPPKQTKVVASRKTVMPISRAGRAQIRRKDSNTQNNMNDQGMEDEEIDQQREGMKNQYEQ
LTAQELNEDMPSKMLEPKNPQAPKNITVYDYYTRKFKTDELVDQMIVHFSMDGDYIWKES
NEYKTQEEIRDTKKALIKEAMRKQESEEPGANHDEEAIKQTLRNKFNYNTRECQTINPSI
RERGVSTEPPPSDTICGNITQWEIFDAYYAEIMKDHQIENKKKKEVDQDKKQDQSMYSTS
FKRCCKIMERMVVQNDQEDKYHDYRYYWSQGDNLEAGKNEGHLLPIWRFSNEKQRKKNVT
SICWNPLYPDLFAVSLGSYDFTKQRMGLICLYSLKNTTHPEYAFNCEAGVMCLDFHPKSA
ALLAVGLYDGTVLVYDIRNKHKKPIYQSTVRNQKHTDPVWQVKWNPDTSKNYNFYSISSD
GRVMNWILMKNKLEPEEVILLRLVGKNEEESTLIGLACGLCFDFNKFEPHIFLVGTEEGK
IHKCSRAYSGQYQETYNGHLLAVYKVKWNNFHPRTFISASADWTVRIWDSKYTSQIICFD
LSMMVVDAVWAPYSSTVFACATMDKVQVYDLNVDKLNKLAEQKIVKQPKLTNLSFNYKDP
ILLVGDSHGGVTLVKLSPNLCKSGPEIKQTEDKKAMEEFKNVKIEDYEREKMENLLAVVS
KWEREDA


>TTHERM_00487150(gene)
ATGCCTCCAAAATAAACAAAAGTTGTAGCCAGCCGTAAGACTGTTATGCCTATTAGTAGA
GCAGGCAGAGCTTAAATCCGTAGAAAGGATTCTAACACTCAAAATAATATGAATGACTAA
GGTATGGAAGATGAGGAAATCGATCAACAAAGAGAGGTATATAATATATTAAATTCACTC
GTAAATTAGATGTCCTCAACAAACAAAACAAATAATACTCTAATTTAAACAAAAATATTT
TAAATATTCTATTTTTGTCTAGCAAAATTTAGAATTGAGCTAGTGTAAAATAAATAAAAA
AATGCTAGGGAAAGGCATTAAATATTGAGGATATTTAAACGAAGATACTACAGTTTAGTT
ATTAATTTAACTAAATTATTTATTTAATGAACTAAAGGGAATGAAGAACCAATACGAACA
ATTAACTGCCCAAGAATTAAATGAAGATATGCCTTCAAAAATGTTAGAGCCAAAGAACCC
TCAAGCTCCTAAAAATATCACTGTTTATGACTATTATACTCGTAAATTTAAGACTGATGA
GTTAGTCGATTAAATGATTGTTCATTTTTCTATGGATGGTGATTATATTTGGAAGGAATC
AAATGAATACAAAACTTAAGAAGAAATTCGTGATACAAAGAAAGCTTTGATCAAGGAAGC
AATGCGTAAATAAGAAAGTGAAGAACCTGGTGCAAACCATGATGAAGAAGCAATTAAATA
AACTCTAAGAAACAAATTTAATTACAATACACGTGAATGTTAAACAATTAATCCTTCAAT
AAGAGAGCGTGGAGTTTCTACCGAACCTCCACCATCTGATACAATCTGTGGCAATATTAC
TCAATGGGAAATTTTTGATGCTTATTATGCAGAAATTATGAAGGTAAAATAACTTATTCT
AAAATAGGCATATATTTTGCTTTTGAAGTAAGCTCAATCAAATTTTAATATCTTTGCAAC
GAAGATTTTACCTTCCGTTGCAAAGCAAGTGATTGAGCAAATGATCAAGCAATTAAGCTA
TATAAAATCAAAATTAGAAGTTACAATTCAATTTATTAGAAGAATGCAAGCAAATCTTTT
TATTTTTCAAAATTGATTTTAAAAAACTAAAAAAAATAAAAATTTTAAAAGATTTAAAAC
AAAAAAGTTACATTTATTTAAAGTTTCTTAAATTTTTCAACTAATATTACTTAGTAGTTT
ATAATTAAATTGGATAAACTGATATTATTATCATTAAAAATATTTAAAATTTCAAAATAT
TAACATTTTTTAAGGAAAATTTGTATCAAAAATAAAATTATTTTTTAGAAAATAAAAACT
CATACATATTAAATTTGATTATATTTCCATTACATAGCATTAAAAATATTATAATAATTT
CAATAAGGATTTTACAATTATATTAAATACAAATTTTATATTTATGTAATCAAATAGGAC
CATCAAATTGAAAATAAAAAGAAGAAAGAGGTTGATTAGGATAAGAAGCAAGATTAGTAA
ATAATTATTATTTAGTATAACTTTGATTTATATAATTATTTTTGTTTTATTTAAAATTAG
ATCTATGTACTCAACTTCGTTCAAAAGATGTTGCAAAATTATGGAACGTATGGTTGTATA
AAACGATTAGGAAGATAAGTATCATGATTATCGTTATTATTGGAGTTAAGGCGACAACCT
AGAAGCTGGTAAAAATGAAGGTAATATATACTTTTAAAAAATGAATTAAGAAAAAACTAA
GATTTTAATTTAAAAATAATATAAAAAAGGTCATTTATTACCTATTTGGAGATTTAGTAA
TGAAAAGCAAAGAAAGAAAAATGTTACTAGTATTTGTTGGAACCCATTATATCCAGATTT
ATTCGCAGTTAGTTTGGGTAGTTATGACTTTACTAAATAGCGTATGGGTTTAATTTGCTT
ATATTCTTTAAAAAACACCACACATCCAGAATATGCCTTCAACTGTGAAGCTGGTGTTAT
GTGTTTAGATTTCCATCCTAAAAGTGCTGCCCTTCTTGCTGTCGGTTTGTATGATGGTAC
TGTGTTAGTTTACGATATCCGTAACAAACACAAGAAACCTATTTATTAATCAACTGTACG
TAATTAAAAGCACACAGATCCTGTCTGGCAAGTTAAATGGAATCCAGATACTTCCAAAAA
TTATAATTTTTATTCCATTTCTAGTGATGGTAGAGTCATGAATTGGATTCTTATGAAAAA
TAAGTTAGAACCTGAAGAAGTTATTTTACTTCGTCTTGTAGGTAAGAATGAAGAGGAATC
AACTTTAATCGGTTTAGCTTGTGGTCTCTGCTTTGATTTCAATAAATTTGAACCTCATAT
CTTCCTTGTAGGTACAGAAGAAGGTAAAATTCATAAGTGTTCTCGTGCTTACTCTGGCTA
GTATTAAGAAACCTACAACGGCCATCTTCTTGCCGTCTACAAAGTTAAGTGGAATAACTT
CCATCCTAGAACTTTCATTTCTGGTAATATTATTTACTATTTATTTCACATCAAAAAATA
AAATAAAAACAAATAAGAATTGTTAAGAGTGAAAATTAAACTATTTTTTAATCTAAAATA
GCTTCTGCTGATTGGACTGTAAGAATTTGGGATAGTAAATACACTTCATAGATTATTTGT
TTTGATTTATCTATGATGGTAGTCGATGCTGTCTGGGCTCCTTACTCATCAACTGGTAAA
TAATTCAAAAATAAATCATAAAAATATAATTTGCTTATTAATAATAATAATAAATACAGT
CTTTGCATGTGCTACTATGGACAAAGTTCAAGTTTATGATTTGAACGTAGATAAACTCAA
TAAATTGGCAGAACAAAAGATTGTTAAATAACCTAAGTTAACTAACTTGTCTTTCAATTA
TAAAGATCCTATCTTGTTAGTTGGTGATTCTCACGGTGGTGTTACTCTTGTCAAGCTCTC
CCCTAATCTTTGCAAAAGTATTTAGCTTTATTATATTAAATGTAGCAATTTAAAAATTTT
TTTAATTTAGGTGGACCTGAAATTAAATAAACTGAAGATAAAAAAGCAATGGAAGAATTT
AAAAATGTAAAAATAGAGGATTACGAAAGAGAAAAGATGGAAAATCTTCTCGCTGTAGTT
AGTAAATGGGAAAGGGAAGATGCTTGA