Identifiers and Description

Gene Model Identifier

TTHERM_00729230

Standard Name

IBD1 (Interactive BromoDomain Protein 1)

Aliases

PreTt07324 | 118.m00152 | 3739.m00074

Description

Bromodomain containing protein. Member of the SWI/SNF, SAGA, SWR complexes and a putative HMT complex during vegetative growth. Member of the SAGA and SWR complex during conjugation at 5 hours.

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 9.9%

TetraMine Data

TTHERM_00729230

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_17985.13.998941839720987e-159bromodomain containing protein
(274 aa)
OxytrichaContig18584.0.g1086.000354955737408e-39Bromodomain
DictyBaseDDB_G02701700.0000000000000030004923591262316DDB_G0270170 on chromosome: 1
position 4360881 to 4366105
Stentor CoeruleusSteCoe_260390.00000000000003442477108469977
SGDYGR252W0.0000000000008001317446409227GCN5 Acetyltransferase, modifi
es N-terminal lysines on histo
nes H2B and H3; acetylates Rsc
4p, a subunit of the RSC chrom
atin-remodeling complex, alter
ing replication stress toleran
ce; catalytic subunit of the A
DA and SAGA histone acetyltran
sferase complexes; founding me
mber of the Gcn5p-related N-ac
etyltransferase superfamily; m
utant displays reduced transcr
iption elongation in the G-les
s-based run-on (GLRO) assay
WormBaseWBGene000174230.000000000006001570085597868status:Confirmed UniProt:O76
561 protein_id:CCD69431.1

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:29523178: Saettone A, Garg J, Lambert JP, Nabeel-Shah S, Ponce M, Burtch A, Thuppu Mudalige C, Gingras AC, Pearlman RE, Fillingham J (2018) The bromodomain-containing protein Ibd1 links multiple chromatin-related protein complexes to highly expressed genes in Tetrahymena thermophila. Epigenetics & chromatin 11(1):10

Sequences

>TTHERM_00729230(coding)
ATGTCAGGTTTTAAGTCTTCTCTTAAATTAAACTAGCATACTAATATAGGAAAAGAAGAA
CTCAAAAAGCTAAATCAAATGCTAAGTTAGCTCTTGCAAAACAATGATTCAATTGAATTT
AGATAAGCAGTTGATTGGAAAGCTTTGGGTTTGATGGACTATCCAAATATTATTAAATAC
CCCATGGATTTAGGCACATGTAAAGAAAAGTTAAAGAATAATGAATACAACTTCGTCGAA
GATTGCCTTGATGATATATAAATAGTTTGGGATAACTGTAAAAATTATAATGCTGAAGGA
TCTTGGATTTATAAATTAGCAGAAAAGTTGGAAAAGCACTTTAAAAATATGATTAAGAAT
TATCTCCCTTCCATATAATTTATGAATGCTGTAGTCAAAAAGGAAAAGCTCTCCTAGATG
AAGATTAATCAAGATGAGAATAGTTCATCTCAAAATGGAGACTAACCAACTCCAGCTAAT
AATACAACTAATGGAAACAAAAATAATGATGCAAATAATGGTACAAGCTAGAATTAAAAT
TAAATATATCAAGAAGAAGAAGCCAGTGAATCTATAACATCTTAAGATAAAATATTATTC
TCCTAGAAAATAAAGATGCTACCCACTGAATAGCTCGGTATGATAGTACTTATGATTTAG
AATAGTGCTTCTTAAGCATTTAAAGATATTGATAAAGAAAAATGTTAGATTCTAGTAGAC
TAAATAGATCCAGAAACATTTAAGAAAATTAATCAGTAAATCGATTTATGGAATGTTAGT
ACTGAAACTACTACAAAGAGAGTGAAGATTTGA


>TTHERM_00729230(protein)
MSGFKSSLKLNQHTNIGKEELKKLNQMLSQLLQNNDSIEFRQAVDWKALGLMDYPNIIKY
PMDLGTCKEKLKNNEYNFVEDCLDDIQIVWDNCKNYNAEGSWIYKLAEKLEKHFKNMIKN
YLPSIQFMNAVVKKEKLSQMKINQDENSSSQNGDQPTPANNTTNGNKNNDANNGTSQNQN
QIYQEEEASESITSQDKILFSQKIKMLPTEQLGMIVLMIQNSASQAFKDIDKEKCQILVD
QIDPETFKKINQQIDLWNVSTETTTKRVKI


>TTHERM_00729230(gene)
ATGTCAGGTTTTAAGTCTTCTCTTAAATTAAACTAGTAATATTGATACCATTTTTTAGAT
TTAGCATAAATAAATTTATTTTATAGCAATTCAATGCTTAAAGAGAGCGAAATTAGTTCA
AATGCAGCTTATTAACTTTTTAATATAATGACCATCATTATTGATTTTTATTTTTAAAAA
TAGGCATACTAATATAGGAAAAGAAGAACTCAAAAAGCTAAATCAAATGCTAAGTTAGCT
CTTGCAAAACAATGATTCAATTGAATTTAGATAAGCAGTTGATTGGAAAGGTAATTTTGA
ATTAATTTTAGAGATTTGGCAAATTTAACTCTATTATTTTGAGATATTTCAAATAATCGA
TTTAAATAGATCAATTAAATTTTGCATACATAAATTATTTTGTGAGTACTAATCAAAATT
GATAATAAAATAAGCTTTGGGTTTGATGGACTATCCAAATATTATTAAATACCCCATGGA
TTTAGGCACATGTAAAGAAAAGTTAAAGAATAATGAATACAACTTCGTCGAAGATTGCCT
TGATGATATATAAATAGTTTGGGATAACTGTAAAAATTATAATGCTGAAGGATCTGTAAT
TAATTAAATTTCAATTATTTAATATTCTTTTAAAAAGAGTTTTTTTTAATTCAAAGATAT
TTTCTAATATTTTTAAAGAAAACAAAAATAATATAATCAAATTAAATCAAATCAATTACA
ATTATACAACCAAAAACAAACCCCTTTTATCTATTTATTTATAATAGCTGTTCTGAAATT
ATTATTTTTATTTTAAATAAAAATATTATTAACTGATAATAAAAATTTTTTAAATTTAAG
ATATTTTTGATTTTTTATAAAGCTAATATTTCGCAGTAACAAAATAAATGGATTTAAATA
TTTTATATATATTTATATCAAGCTTTAAAAATAAAATAAATTAATCAATGCTAATTTTCA
AGTACCAATAAAAAATGAATAACTAAAAAATAAATTTTATAATTTTAAATGTAGGTTTAT
ATAAAAAAATAAAATCAAAAGCAAAGTATAAATCTATTAGCAAACAATTTTTAAAAACAT
GATTATTTGATTAATGAGAAGATTTTCACAAGATTTAATTTACAAAATAAATATATTTAA
AATAATATTAAAATGAATTTATTTTTCATTTTTTTCAAATAATTTTTGAATGTATTTTGG
TTTTATGTAAAAATAAAATTATTATGATCAAAACCATACTGGTTTTAGTAAAAGAAGTTG
AAAAAATTTTTCTGTTTTTTATTTTTAAAAATTGTTTTTTTTTCTTTAAAAACTTGAAGA
AAAATATTTAAAATTATTTAATATCTCCTTGTTAATTAATAAATATTTATAATAATTTTT
AAAATAGTGGATTTATAAATTAGCAGAAAAGTTGGAAAAGCACTTTAAAAATATGATTAA
GAATTATCTCCCTTCCATATAATTTATGAATGCTGTAGTCAGTAAAAAATTAGTTTTTTG
ATAATGATTTATAGCTTTTAACTTGAATTTTGTGATTAAAATTTTTTTCATTAAATAGAA
AAGGAAAAGCTCTCCTAGATGAAGATTAATCAAGATGAGAAGTATCTTATTCATTTATTA
TTTAAGAATTAATGAATAATTTATTTTATAATTAATTATATAAGTAGTTCATCTCAAAAT
GGAGACTAACCAACTCCAGCTAATAATACAACTAATGGAAACAAAAATAATGATGCAAAT
AATGGTACAAGCTAGAATTAAAATTAAATATATCAAGAAGAAGAAGCCAGTGAATCTATA
ACATCTTAAGATAAAATATTATTCTCCTAGAAAATAAAGATGCTACCCACTGAATAGCTC
GGTATGATAGTACTTATGATTTAGAATAGTGCTTCTTAAGCATTTAAAGATATTGATAAA
GAAAAATGTTAGATTCTAGTAGACTAAATAGATCCAGAAACATTTAAGAAAATTAATCAG
TAAATTATTATAATTTGATATTAATTATTAGCTGATTTTATAGAAAAAATATAATTTAAA
TTTTATACTATTTTGAAAATATAAGTTTTTATTAATTTAATTATTATAACTAGGTAAATC
GATTTATGGAATGTTAGTACTGAAACTACTACAAAGAGAGTGAAGATTTGA