Identifiers and Description

Gene Model Identifier

TTHERM_00283180

Standard Name

HTB2 (Histone h Two B )

Aliases

PreTt04857 | 25.m00321 | histone H2B-2 | 3694.m00104

Description

Histone H2B; one of the four histones (H2A, H2B, H3 and H4) that comprise the protein core of the eukaryotic nucleosome; differs from Htb1p by three amino acids

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Domains

  • ( PF00125 ) Core histone H2A/H2B/H3/H4
  • ( PF00808 ) Histone-like transcription factor (CBF/NF-Y) and

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.7%

TetraMine Data

TTHERM_00283180

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_15821.12.0001503375893664e-79core histone H2A/H2B/H3/H4 fam
ily protein (122 aa)
OxytrichaContig678.1.g534.001202823045957e-54Core histone H2A/H2B/H3/H4
WormBaseWBGene000019155.999460549133178e-49locus:his-41 Probable histon
e H2B 3 status:Confirmed U
niProt:Q27484 protein_id:CAA
94740.1
SGDYDR224C3.9991604984848653e-48HTB1 Histone H2B, core histone
protein required for chromati
n assembly and chromosome func
tion; nearly identical to HTB2
; Rad6p-Bre1p-Lge1p mediated u
biquitination regulates transc
riptional activation, meiotic
DSB formation and H3 methylati
on
DictyBaseDDB_G02865096.998020510507768e-25H2Bv3 on chromosome: 4 positio
n 4575107 to 4575571
Stentor CoeruleusSteCoe_21983.532628572200807e-24

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:19822522: Wang Z, Cui B, Gorovsky MA (2009) Histone H2B ubiquitylation is not required for histone H3 methylation at lysine 4 in tetrahymena. The Journal of biological chemistry 284(50):34870-9
  2. Ref:15199121: Medzihradszky KF, Zhang X, Chalkley RJ, Guan S, McFarland MA, Chalmers MJ, Marshall AG, Diaz RL, Allis CD, Burlingame AL (2004) Characterization of Tetrahymena histone H2B variants and posttranslational populations by electron capture dissociation (ECD) Fourier transform ion cyclotron mass spectrometry (FT-ICR MS). Molecular & cellular proteomics : MCP 3(9):872-86
  3. Ref:8760889: Liu X, Gorovsky MA (1996) Cloning and characterization of the major histone H2A genes completes the cloning and sequencing of known histone genes of Tetrahymena thermophila. Nucleic acids research 24(15):3023-30
  4. Ref:2713375: Nickel BE, Allis CD, Davie JR (1989) Ubiquitinated histone H2B is preferentially located in transcriptionally active chromatin. Biochemistry 28(3):958-63
  5. Ref:3131141: Brandt WF, de Andrade Rodrigues J, von Holt C (1988) The amino acid sequence of wheat histone H2B(2). A core histone with a novel repetitive N-terminal extension. European journal of biochemistry 173(3):547-54
  6. Ref:3039463: Nomoto M, Imai N, Saiga H, Matsui T, Mita T (1987) Characterization of two types of histone H2B genes from macronuclei of Tetrahymena thermophila. Nucleic acids research 15(14):5681-97
  7. Ref:6804458: Nomoto M, Hayashi H, Iwai K (1982) Tetrahymena histone H2B. Complete amino acid sequence. Journal of biochemistry 91(3):897-904
  8. Ref:6818230: Nomoto M, Kyogoku Y, Iwai K (1982) N-Trimethylalanine, a novel blocked N-terminal residue of Tetrahymena histone H2B. Journal of biochemistry 92(5):1675-8

Sequences

>TTHERM_00283180(coding)
ATGGCTCCCAAGAAAGCTCCCGCTGCTACTACTGAAAAGAAGGTCAAGAAGGCCCCCACC
ACCGAAAAGAAGAACAAGAAGAAGAGATCAGAAACCTTCGCTATTTATATCTTCAAGGTC
TTAAAGCAAGTCCACCCTGATGTCGGTATTTCCAAGAAGGCTATGAACATTATGAACTCT
TTCATTAACGACTCCTTCGAAAGAATCGCCCTCGAATCTTCCAAGTTAGTCAGATTCAAT
AAGAGAAGAACCCTCTCATCCAGGGAAGTCTAAACTGCCGTCAAGCTCTTATTACCTGGT
GAACTCGCTAGACACGCTATCTCCGAAGGTACCAAGGCCGTCACCAAGTTCTCTTCTTCC
TCCAATTGA


>TTHERM_00283180(protein)
MAPKKAPAATTEKKVKKAPTTEKKNKKKRSETFAIYIFKVLKQVHPDVGISKKAMNIMNS
FINDSFERIALESSKLVRFNKRRTLSSREVQTAVKLLLPGELARHAISEGTKAVTKFSSS
SN


>TTHERM_00283180(gene)
ATGGCTCCCAAGAAAGCTCCCGCTGCTACTACTGAAAAGAAGGTCAAGAAGGCCCCCACC
ACCGAAAAGAAGAACAAGAAGAAGAGATCAGAAACCTTCGCTATTTATATCTTCAAGGTC
TTAAAGCAAGTCCACCCTGATGTCGGTATTTCCAAGAAGGCTATGAACATTATGAACTCT
TTCATTAACGACTCCTTCGAAAGAATCGCCCTCGAATCTTCCAAGTTAGTCAGATTCAAT
AAGAGAAGAACCCTCTCATCCAGGGAAGTCTAAACTGCCGTCAAGCTCTTATTACCTGGT
GAACTCGCTAGACACGCTATCTCCGAAGGTACCAAGGCCGTCACCAAGTTCTCTTCTTCC
TCCAATTGA