Identifiers and Description

Gene Model Identifier

TTHERM_01079200

Standard Name

HTA4 (Histone Two A 4)

Aliases

PreTt17435 | 221.m00055 | 3832.m00156 | HTAY

Description

Core histone H2A variant

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Domains

  • ( PF00560 ) Leucine Rich Repeat
  • ( PF00125 ) Core histone H2A/H2B/H3/H4
  • ( PF04719 ) hTAFII28-like protein conserved region
  • ( PF00808 ) Histone-like transcription factor (CBF/NF-Y) and

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 12.2%

TetraMine Data

TTHERM_01079200

WebApollo

Fullscreen View

Tetrahymena Stock Center

  • ( SD01786 ) Macronucleus: Neo3 KO of HTAY(may be incomplete) and HTAY with two HA tags on the N-terminus inserted into MTT1 locus with neo2 cassete in 5' flanking region
  • ( SD01997 ) Macronucleus: Neo3 KO of HTAY (may be incomplete) and HTAY with two HA tags on the N-terminus inserted into MTT1 locus with neo2 cassete in 5' flanking region
  • ( SD01769 ) Macronucleus: Flag C-terminal tagged HTAY gene fragment coding for AA123 to 388 into MTT1 locus
  • ( SD02368 ) Macronucleus: 2 HA tagged HTAY into MTT1 with neo2 in 5' flank
  • ( SD02381 ) Micronucleus: Neo3 replaces bases coding for AA258-388 Macronucleus: Neo3 replaces bases coding for AA258-388
  • ( SD02676 ) Micronucleus: Neo3 ko of last 2/3 (AA123-388) of HTAY gene Macronucleus: Neo3 ko of last 2/3 (AA123-388) of HTAY gene
  • ( SD02677 ) Micronucleus: Neo3 ko of last 2/3 (AA123-388) of HTAY gene Macronucleus: Neo3 ko of last 2/3 (AA123-388) of HTAY gene
  • ( SD02678 ) Micronucleus: Neo3 ko of last 2/3 (AA123-388) of HTAY gene
  • ( SD02679 ) Micronucleus: Neo3 ko of last 2/3 (AA123-388) of HTAY gene
  • ( SD02680 ) Micronucleus: Neo3 ko of last 2/3 (AA123-388) of HTAY gene
  • ( SD02700 ) Macronucleus: 3HA n-terminal tagged HTAY gene fragment coding for AA123 to 388into MTT1 locus
  • ( SD02701 ) Macronucleus: Flag tagged 2/3 c-terminus of HTAY into MTT1 locus
  • ( SD02808 ) Macronucleus: Partial ko of HTAY coding with neo3
  • ( SD02809 ) Macronucleus: Partial ko of HTAY coding with neo3
  • ( SD02881 ) Macronucleus: Partial replacement of MTT1 coding by N-terminus of HTAY, aa 1-122, with neo2 in 5’ flank of MTT1
  • ( SD02882 ) Macronucleus: Region of HTAY gene encoding AA 123 to 257 with two HA tags at n-terminus was inserted into the MTT1 gene.
  • ( SD02883 ) Macronucleus: Region of HTAY gene encoding AA 258 to 388 with two HA tags at n-terminus was inserted into the MTT1 gene.
  • ( SD02884 ) Macronucleus: Region of HTAY gene encoding AA 1 to 258 with two HA tags at n-terminus was inserted into the MTT1 gene.
  • ( SD02885 ) Macronucleus: Region of HTAY gene encoding AA 1 to 122 and 258 to 388 with two HA tags at n-terminus was inserted into the MTT1 gene.
  • ( SD02200 ) Macronucleus: Neo3 into HTAY, Chimeric YN-HTAX into MTT1 locus
  • ( SD02201 ) Macronucleus: Neo3 into HTAY, Chimeric YN-HTAX into MTT1 locus
  • ( SD02203 ) Macronucleus: Neo3 into HTAY, Chimeric YN-HTAX into MTT1 locus
  • ( SD02202 ) Macronucleus: Neo3 into HTAY, Chimeric YN-HTAX into MTT1 locus

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_20318.19.997093137033517e-262core histone H2A/H2B/H3/H4 fam
ily protein (381 aa)
OxytrichaContig9320.0.g502.000130478826482e-26Core histone H2A/H2B/H3/H4
SGDYDR225W4.0013320766793207e-25HTA1 Histone H2A, core histone
protein required for chromati
n assembly and chromosome func
tion; one of two nearly identi
cal subtypes (see also HTA2);
DNA damage-dependent phosphory
lation by Mec1p facilitates DN
A repair; acetylated by Nat4p
WormBaseWBGene000018862.000620012690291e-23locus:his-12 Histone H2A s
tatus:Predicted UniProt:P095
88 protein_id:CAB05838.1
DictyBaseDDB_G02796674.0002685161515803e-16H2AX on chromosome: 3 position
2410613 to 2411077
Stentor CoeruleusSteCoe_259620.0000000000018795288165390832

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:22426537: Song X, Bowen J, Miao W, Liu Y, Gorovsky MA (2012) The nonhistone, N-terminal tail of an essential, chimeric H2A variant regulates mitotic H3-S10 dephosphorylation. Genes & development 26(6):615-29
  2. Ref:16933976: Eisen JA, Coyne RS, Wu M, Wu D, Thiagarajan M, Wortman JR, Badger JH, Ren Q, Amedeo P, Jones KM, Tallon LJ, Delcher AL, Salzberg SL, Silva JC, Haas BJ, Majoros WH, Farzad M, Carlton JM, Smith RK, Garg J, Pearlman RE, Karrer KM, Sun L, Manning G, Elde NC, Turkewitz AP, Asai DJ, Wilkes DE, Wang Y, Cai H, Collins K, Stewart BA, Lee SR, Wilamowska K, Weinberg Z, Ruzzo WL, Wloga D, Gaertig J, Frankel J, Tsao CC, Gorovsky MA, Keeling PJ, Waller RF, Patron NJ, Cherry JM, Stover NA,

Sequences

>TTHERM_01079200(coding)
ATGTTGATTAACTCTATATTAGATTTTAATAGTATCAAATCTTTTAATTCGATAGTATAA
ATAAAAAACTTATATATACAAATAAAGATATTAATAATAACTTTGACAAACATTTTTACA
AAAAATAAAAAATAAGTTAAATAAACACAACAATAATCTTTAAAAATGTCAACTGACTAA
GAAAAGATAATAAAATAAGTATTAGATTCAATAGCAGAGCAATAGGGAGATAGTAGAGAT
GATGAAGTTTATGTGATAGAAATAATGTCATTACGCTTTGAGAAATTTGATAATCGAATT
AAGTAGAAGATTGAAAGATTTACATCTCTTTAAATGCTAACAATCAACGATTGCCTTATC
TCTGATTTAACTAACTTCCCTCATGTTCCTTCTTTGATTAGATTAGACTTGGTCTTTAAT
AAAATTACTGGAGACTAGCTTTAATATTTGAGAGGATCAAGACATTTACAAACTTTAATG
CTTGGTGCAAATTAAATTGAAGAGATCGAAGACTTGAAGAGACTCGGTTAGATGAGAGAA
TTAATTCAACTAGATTTATTGAATAATCCAGTTGTTAATACAAATAATTATAGAAATTTA
GTTTTTAATTTGTTTCCTTCTTTGGTAATATTAGACACTTTAGATAAAAATGGAATTGAT
TAAGAAAAAGCAGCTCTTGATATTTCTGCTTCAAGAGTGCCTGATAACTTATTTGATAAA
TCTAAGCCTGTATAAAATGTTTCCAAATAAGTAGTTAAAAATGCTAAAGCTACTTAAAAT
AATCTTTTCAGTTCTACACAAAAAGTAGCTTAAGTTAAATAAATTCCCAAAATTGTACCT
GCAAAAGTATCTAAGCCTTCTCAAGCATCAGTTTAAGACAACAAATCTAATGTAGTTTAA
GCAAAAGTTACTGCTGCTGTAAGTGTTGGTAGAAAAGCACCTGCATCAAGAAATGGTGGA
GTACCATCAAAAGCTGGAAAAGGCAAAATGAATGCTTTTTCAAAGTAGTCTACATCTCAA
AAAAGTGGTTTAGTATTTCCTTGTGGAAGACTTAGAAGATACTTGAAACAGGCTTGCAAA
CAATTTAGAGTTTCTTCAAGCTGTAACATTTACTTAGCTGGTGTTCTTGAATACTTAGCA
GCAGAAGTCTTAGAAACTGCAGGAAATATAGCAAAAAACAATAGGCTAAGTAGAATTAAC
CCAGTTCATATAAGAGAAGCTTTTAGAAACGATGCTGAGTTAAACTAATTTGTAAATGGT
ACTATTATAGCTGAAGGAGGAAGCACAAGTACTAATTTTGTCCTTCCAATTATTAATAAA
TCCAAAAAATGA


>TTHERM_01079200(protein)
MLINSILDFNSIKSFNSIVQIKNLYIQIKILIITLTNIFTKNKKQVKQTQQQSLKMSTDQ
EKIIKQVLDSIAEQQGDSRDDEVYVIEIMSLRFEKFDNRIKQKIERFTSLQMLTINDCLI
SDLTNFPHVPSLIRLDLVFNKITGDQLQYLRGSRHLQTLMLGANQIEEIEDLKRLGQMRE
LIQLDLLNNPVVNTNNYRNLVFNLFPSLVILDTLDKNGIDQEKAALDISASRVPDNLFDK
SKPVQNVSKQVVKNAKATQNNLFSSTQKVAQVKQIPKIVPAKVSKPSQASVQDNKSNVVQ
AKVTAAVSVGRKAPASRNGGVPSKAGKGKMNAFSKQSTSQKSGLVFPCGRLRRYLKQACK
QFRVSSSCNIYLAGVLEYLAAEVLETAGNIAKNNRLSRINPVHIREAFRNDAELNQFVNG
TIIAEGGSTSTNFVLPIINKSKK


>TTHERM_01079200(gene)
GGGTACTATCAGAATTTATGTTGATTAACTCTATATTAGATTTTAATAGTATCAAATCTT
TTAATTCGATAGTATAAATAAAAAACTTATATATACAAATAAAGATATTAATAATAACTT
TGACAAACATTTTTACAAAAAATAAAAAATAAGTTAAATAAACACAACAATAATCTTTAA
AAATGTCAACTGACTAAGAAAAGATAATAAAATAAGTATTAGATTCAATAGCAGAGCAAT
AGGGAGATAGTAGAGATGATGAAGTTTATGTGATAGAAATAATGTCATTACGCTTTGAGA
AATTTGATAATCGAATTAAGTAGAAGATTGAAAGATTTACATCTCTTTAAATGCTAACAA
TCAACGATTGCCTTATCTCTGATTTAACTAACTTCCCTCATGTTCCTTCTTTGATTAGAT
TAGACTTGGTCTTTAATAAAATTACTGGAGACTAGCTTTAATATTTGAGAGGATCAAGAC
ATTTACAAACTTTAATGCTTGGTGCAAATTAAATTGAAGAGATCGAAGACTTGAAGAGAC
TCGGTTAGATGAGAGAATTAATTCAACTAGATTTATTGAATAATCCAGTTGTTAATACAA
ATAATTATAGAAATTTAGTTTTTAATTTGTTTCCTTCTTTGGTAATATTAGACACTTTAG
ATAAAAATGGAATTGATTAAGAAAAAGCAGCTCTTGATATTTCTGCTTCAAGAGTGCCTG
ATAACTTATTTGATAAATCTAAGCCTGTATAAAATGTTTCCAAATAAGTAGTTAAAAATG
CTAAAGCTACTTAAAATAATCTTTTCAGTTCTACACAAAAAGTAGCTTAAGTTAAATAAA
TTCCCAAAATTGTACCTGCAAAAGTATCTAAGCCTTCTCAAGCATCAGTTTAAGACAACA
AATCTAATGTAGTTTAAGCAAAAGTTACTGCTGCTGTAAGTGTTGGTAGAAAAGCACCTG
CATCAAGAAATGGTGGAGTACCATCAAAAGCTGGAAAAGGCAAAATGAATGCTTTTTCAA
AGTAGTCTACATCTCAAAAAAGTGGTTTAGTATTTCCTTGTGGAAGACTTAGAAGATACT
TGAAACAGGCTTGCAAACAATTTAGAGTTTCTTCAAGCTGTAACATTTACTTAGCTGGTG
TTCTTGAATACTTAGCAGCAGAAGTCTTAGAAACTGCAGGAAATATAGCAAAAAACAATA
GGCTAAGTAGAATTAACCCAGTTCATATAAGAGAAGCTTTTAGAAACGATGCTGAGTTAA
ACTAATTTGTAAATGGTACTATTATAGCTGAAGGAGGAAGCACAAGTACTAATTTTGTCC
TTCCAATTATTAATAAATCCAAAAAATGATTAAAAAAAAAATTCAAGTTAAATAAAATAT
AAAAATAAAAATAATCACTAAATAATTTATCAATATAAAATAATTTAAAAATAAATATAG
TTTATAATATTAATAAATAAATAAATAAATAAAATAATCATTAACATTATTTTCATTTTA
TTGTCATTTTATTTCCAAATTTAAGTCCTAAAGTTTATTGTAATATCAATGAGATTTCTT
TAAAATTTTAAAAATTCG