Identifiers and Description

Gene Model Identifier

TTHERM_00143660

Standard Name

HTA3 (Histone h Two A )

Aliases

PreTt26673 | 11.m00370 | histone H2A var hv1 | hv1 | H2A.Z | 3702.m00093

Description

Histone H2A (variant H2A.Z); essential protein; regulated by acetylation, which modulates charge patch on its N-terminal tail; comprises about 20% of total H2A protein in Tetrahymena; found only in transcriptionally active nuclei

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

  • ( PF00125 ) Core histone H2A/H2B/H3/H4
  • ( PF00808 ) Histone-like transcription factor (CBF/NF-Y) and

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00143660

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_04805.13.000935899181433e-99core histone H2A/H2B/H3/H4 fam
ily protein (147 aa)
OxytrichaContig16838.0.g303.0014802379878627e-60Core histone H2A/H2B/H3/H4
WormBaseWBGene000199475.002488024924283e-58locus:htz-1 Histone H2A.V
status:Confirmed UniProt:Q27
511 protein_id:CCD73086.1
SGDYOL012C8.000462645699572e-47HTZ1 Histone variant H2AZ, exc
hanged for histone H2A in nucl
eosomes by the SWR1 complex; i
nvolved in transcriptional reg
ulation through prevention of
the spread of silent heterochr
omatin
DictyBaseDDB_G02867471.0004783691736523e-35H2AZ on chromosome: 4 position
4922308 to 4922992
Stentor CoeruleusSteCoe_350653.221340285992516e-27

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00143660(coding)
ATGGCTGGCGGAAAAGGCGGTAAAGGTGGTAAAGGTGGCAAAGGTGGTAAAGTCGGAGGC
GCCAAGAATAAGAAGACTCCTCAATCACGTTCTTATAAGGCTGGTTTATAATTCCCAGTC
GGTAGAATCCACAGATTTTTGAAGGGTAGAGTTAGTGCTAAGAACAGAGTTGGTGCTACT
GCTGCTGTTTATGCTGCTGCTATTTTGGAATATTTAACAGCAGAAGTTTTGGAATTGGCT
GGTAATGCTTCTAAGGATTTCAAAGTCAGAAGAATCACTCCTCGTCACTTGCTCTTGGCT
ATTAGAGGTGATGAAGAATTAGATATTTTGATCAAGGCTACCATTGCTGGTGGTGGTGTC
ATTCCTCACATCCATAAAGCTCTCTTGGGTAAGCACTCTACTAAAAACAGATCTAGTGCT
AAGACTGCTGAACCTCGTTGA


>TTHERM_00143660(protein)
MAGGKGGKGGKGGKGGKVGGAKNKKTPQSRSYKAGLQFPVGRIHRFLKGRVSAKNRVGAT
AAVYAAAILEYLTAEVLELAGNASKDFKVRRITPRHLLLAIRGDEELDILIKATIAGGGV
IPHIHKALLGKHSTKNRSSAKTAEPR


>TTHERM_00143660(gene)
ATGGTAATTTAAATTTTTTTTAGAGTGGCTTAATCTCATTTTTAATCAATTTTCAAATAA
AATAGGCTGGCGGAAAAGGCGGTAAAGGTGGTAAAGGTGGCAAAGGTGGTAAAGTCGGAG
GCGCCAAGAATAAGAAGACTCCTCAATCACGTTCTTATAAGGCTGGTTTATAAGTAATAT
TGGCATCAGGATGTCCATCATTCTGAGCATTTGACTCAGTTGTGATTTTATTAACGCTAA
AATATTATAATAATAAAGTTCCCAGTCGGTAGAATCCACAGATTTTTGAAGGGTAGAGTT
AGTGCTAAGAACAGAGTTGGTGCTACTGCTGCTGTTTATGCTGCTGCTATTTTGGAATAT
TTAACAGCAGAAGTTTTGGAATTGGCTGGTAATGCTTCTAAGGATTTCAAAGTCAGAAGA
ATCACTCCTCGTCACTTGCTCTTGGCTATTAGAGGTGATGAAGAATTAGATATTTTGATC
AAGGCTACCATTGCTGGTGGTGGTGTCATTCCTCACATCCATAAAGCTCTCTTGGGTAAG
CACTCTACTAAAAACAGATCTAGTGCTAAGACTGCTGAACCTCGTTGA