Identifiers and Description

Gene Model Identifier

TTHERM_00143660

Standard Name

HTA3 (Histone h Two A 3 )

Aliases

PreTt26673 | 11.m00370 | histone H2A var hv1 | hv1 | H2A.Z | 3702.m00093

Description

Histone H2A (variant H2A.Z); essential protein; regulated by acetylation, which modulates charge patch on its N-terminal tail; comprises about 20% of total H2A protein in Tetrahymena; found only in transcriptionally active nuclei

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

  • ( PF00125 ) Core histone H2A/H2B/H3/H4
  • ( PF00808 ) Histone-like transcription factor (CBF/NF-Y) and

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 9.9%

TetraMine Data

TTHERM_00143660

WebApollo

Fullscreen View

Tetrahymena Stock Center

  • ( SD02070 ) Micronucleus: Neo2 in HTAZ Macronucleus: HTAZ coding replaced with mutations K4R,K7R,K10R,K13R, K21R.
  • ( SD02071 ) Micronucleus: Neo2 in HTAZ Macronucleus: HTAZ coding replaced with mutations K4R,K7R,K10R,K16R, K21R.
  • ( SD02072 ) Micronucleus: Neo2 in HTAZ Macronucleus: HTAZ coding replaced with mutations Del4-24 aa.
  • ( SD02073 ) Micronucleus: Neo2 in HTAZ Macronucleus: HTAZ coding replaced with mutations K4Q,K7Q,K10Q,K13Q,K16Q,K21R
  • ( SD02074 ) Micronucleus: Neo2 in HTAZ Macronucleus: HTAZ coding replaced with mutations K4Q,K7R,K10Q,K13Q,K16Q,K21Q
  • ( SD02075 ) Micronucleus: Neo2 in HTAZ Macronucleus: HTAZ coding replaced with mutations K7R,K10R,K13R,K16R,K21R
  • ( SD02076 ) Micronucleus: Neo2 in HTAZ Macronucleus: HTAZ coding replaced with mutations K4R,K10R,K13R,K16R,K21R
  • ( SD02454 ) Macronucleus: GFP tagged HTAZ
  • ( SD02455 ) Micronucleus: Neo2 in HTAZ Macronucleus: HTAZ coding replaced with mutations K4Q,K7R,K10Q,K13Q,K16Q,K21Q
  • ( SD02456 ) Micronucleus: Neo2 in HTAZ Macronucleus: HTAZ coding replaced with mutations K4R, K7R,K10R,K13R,K16R.
  • ( SD02457 ) Micronucleus: Neo2 in HTAZ Macronucleus: HTAZ coding replaced with mutation K130R
  • ( SD02458 ) Micronucleus: Neo2 in HTAZ Macronucleus: HTAZ coding replaced with mutation K130R
  • ( SD02462 ) Macronucleus: inserted HTAZ with K4R Into MTT1 locus and neo2 in 5’ flanking of MTT1
  • ( SD02463 ) Macronucleus: inserted HTAZ with K4R,K7R,K10R,K13R K16R, K21R Into MTT1 locus and neo2 in 5’ flanking of MTT1
  • ( SD02464 ) Micronucleus: Neo2 in HTAZ Macronucleus: HTAZ coding replaced with mutations K4R, K7R,K10R,K13R,K16R,K21R,K23Q, K24Q
  • ( SD02465 ) Micronucleus: Neo2 in HTAZ Macronucleus: H2A.Z with a major H2A.1 n-terminal tail, S1V and 5R mutations.
  • ( SD02672 ) Micronucleus: neo2 into HTAZ coding
  • ( SD02673 ) Micronucleus: neo2 into HTAZ coding
  • ( SD02674 ) Micronucleus: neo2 into HTAZ coding
  • ( SD02675 ) Micronucleus: neo2 into HTAZ coding
  • ( SD02684 ) Micronucleus: Neo2 in HTAZ Macronucleus: HTAZ coding
  • ( SD02685 ) Micronucleus: Neo2 in HTAZ Macronucleus: HTAZ coding,
  • ( SD02686 ) Micronucleus: Neo2 in HTAZ Macronucleus: HTAZ coding
  • ( SD02687 ) Micronucleus: Neo2 in HTAZ Macronucleus: HTAZ coding
  • ( SD02688 ) Micronucleus: neo2 replaces HTAZ coding Macronucleus: HTAZ coding either neo2 or mutated to K130R
  • ( SD02689 ) Micronucleus: neo2 replaces HTAZ coding Macronucleus: HTAZ coding either neo2 or mutated to K130R
  • ( SD02690 ) Micronucleus: neo2 replaces HTAZ coding Macronucleus: HTAZ coding either neo2 or mutated to K130R
  • ( SD02691 ) Micronucleus: neo2 replaces HTAZ coding Macronucleus: HTAZ coding either neo2 or mutated to K130R
  • ( SD02874 ) Macronucleus: neo2 into HTA3
  • ( SD02875 ) Macronucleus: neo2 into HTA3

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_04805.13.000935899181433e-99core histone H2A/H2B/H3/H4 fam
ily protein (147 aa)
OxytrichaContig16838.0.g303.0014802379878627e-60Core histone H2A/H2B/H3/H4
WormBaseWBGene000199475.002488024924283e-58locus:htz-1 Histone H2A.V
status:Confirmed UniProt:Q27
511 protein_id:CCD73086.1
SGDYOL012C8.000462645699572e-47HTZ1 Histone variant H2AZ, exc
hanged for histone H2A in nucl
eosomes by the SWR1 complex; i
nvolved in transcriptional reg
ulation through prevention of
the spread of silent heterochr
omatin
DictyBaseDDB_G02867471.0004783691736523e-35H2AZ on chromosome: 4 position
4922308 to 4922992
Stentor CoeruleusSteCoe_350653.221340285992516e-27

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00143660(coding)
ATGGCTGGCGGAAAAGGCGGTAAAGGTGGTAAAGGTGGCAAAGGTGGTAAAGTCGGAGGC
GCCAAGAATAAGAAGACTCCTCAATCACGTTCTTATAAGGCTGGTTTATAATTCCCAGTC
GGTAGAATCCACAGATTTTTGAAGGGTAGAGTTAGTGCTAAGAACAGAGTTGGTGCTACT
GCTGCTGTTTATGCTGCTGCTATTTTGGAATATTTAACAGCAGAAGTTTTGGAATTGGCT
GGTAATGCTTCTAAGGATTTCAAAGTCAGAAGAATCACTCCTCGTCACTTGCTCTTGGCT
ATTAGAGGTGATGAAGAATTAGATATTTTGATCAAGGCTACCATTGCTGGTGGTGGTGTC
ATTCCTCACATCCATAAAGCTCTCTTGGGTAAGCACTCTACTAAAAACAGATCTAGTGCT
AAGACTGCTGAACCTCGTTGA


>TTHERM_00143660(protein)
MAGGKGGKGGKGGKGGKVGGAKNKKTPQSRSYKAGLQFPVGRIHRFLKGRVSAKNRVGAT
AAVYAAAILEYLTAEVLELAGNASKDFKVRRITPRHLLLAIRGDEELDILIKATIAGGGV
IPHIHKALLGKHSTKNRSSAKTAEPR


>TTHERM_00143660(gene)
ATGGTAATTTAAATTTTTTTTAGAGTGGCTTAATCTCATTTTTAATCAATTTTCAAATAA
AATAGGCTGGCGGAAAAGGCGGTAAAGGTGGTAAAGGTGGCAAAGGTGGTAAAGTCGGAG
GCGCCAAGAATAAGAAGACTCCTCAATCACGTTCTTATAAGGCTGGTTTATAAGTAATAT
TGGCATCAGGATGTCCATCATTCTGAGCATTTGACTCAGTTGTGATTTTATTAACGCTAA
AATATTATAATAATAAAGTTCCCAGTCGGTAGAATCCACAGATTTTTGAAGGGTAGAGTT
AGTGCTAAGAACAGAGTTGGTGCTACTGCTGCTGTTTATGCTGCTGCTATTTTGGAATAT
TTAACAGCAGAAGTTTTGGAATTGGCTGGTAATGCTTCTAAGGATTTCAAAGTCAGAAGA
ATCACTCCTCGTCACTTGCTCTTGGCTATTAGAGGTGATGAAGAATTAGATATTTTGATC
AAGGCTACCATTGCTGGTGGTGGTGTCATTCCTCACATCCATAAAGCTCTCTTGGGTAAG
CACTCTACTAAAAACAGATCTAGTGCTAAGACTGCTGAACCTCGTTGA