Identifiers and Description

Gene Model Identifier

TTHERM_00790790

Standard Name

HTA1 (Histone h Two A )

Aliases

PreTt01369 | 133.m00094

Description

Histone H2A; one of the four histones (H2A, H2B, H3 and H4) that comprise the nucleosome core; one of two major histone H2A genes (with HTA2); knockout viable, but double knockout with HTA2 inviable

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Domains

  • ( PF00125 ) Core histone H2A/H2B/H3/H4
  • ( PF00808 ) Histone-like transcription factor (CBF/NF-Y) and

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00790790

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_05608.11.0001689416974253e-96core histone H2A/H2B/H3/H4 fam
ily protein (139 aa)
OxytrichaContig22612.0.g355.9981191891941984e-64Core histone H2A/H2B/H3/H4
SGDYBL003C9.997652352281279e-57HTA2 Histone H2A, core histone
protein required for chromati
n assembly and chromosome func
tion; one of two nearly identi
cal (see also HTA1) subtypes;
DNA damage-dependent phosphory
lation by Mec1p facilitates DN
A repair; acetylated by Nat4p
WormBaseWBGene000019099.995951036711152e-55locus:his-35 Histone H2A s
tatus:Confirmed UniProt:Q274
85 protein_id:CAA94747.1
DictyBaseDDB_G02796671.0004783691736523e-35H2AX on chromosome: 3 position
2410613 to 2411077
Stentor CoeruleusSteCoe_259622.1705220113036395e-29

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:12665578: Ren Q, Gorovsky MA (2003) The nonessential H2A N-terminal tail can function as an essential charge patch on the H2A.Z variant N-terminal tail. Molecular and cellular biology 23(8):2778-89
  2. Ref:11000274: Jackson JD, Gorovsky MA (2000) Histone H2A.Z has a conserved function that is distinct from that of the major H2A sequence variants. Nucleic acids research 28(19):3811-6
  3. Ref:10385122: Clarkson MJ, Wells JR, Gibson F, Saint R, Tremethick DJ (1999) Regions of variant histone His2AvD required for Drosophila development. Nature 399(6737):694-7
  4. Ref:8760889: Liu X, Gorovsky MA (1996) Cloning and characterization of the major histone H2A genes completes the cloning and sequencing of known histone genes of Tetrahymena thermophila. Nucleic acids research 24(15):3023-30
  5. Ref:8649398: Liu X, Bowen J, Gorovsky MA (1996) Either of the major H2A genes but not an evolutionarily conserved H2A.F/Z variant of Tetrahymena thermophila can function as the sole H2A gene in the yeast Saccharomyces cerevisiae. Molecular and cellular biology 16(6):2878-87
  6. Ref:8754831: Liu X, Li B, GorovskyMA (1996) Essential and nonessential histone H2A variants in Tetrahymena thermophila. Molecular and cellular biology 16(8):4305-11
  7. Ref:8177745: Liu X, Gorovsky MA (1993) Mapping the 5' and 3' ends of Tetrahymena thermophila mRNAs using RNA ligase mediated amplification of cDNA ends (RLM-RACE). Nucleic acids research 21(21):4954-60
  8. Ref:2587254: Mannironi C, Bonner WM, Hatch CL (1989) H2A.X. a histone isoprotein with a conserved C-terminal sequence, is encoded by a novel mRNA with both DNA replication type and polyA 3' processing signals. Nucleic acids research 17(22):9113-26
  9. Ref:3131141: Brandt WF, de Andrade Rodrigues J, von Holt C (1988) The amino acid sequence of wheat histone H2B(2). A core histone with a novel repetitive N-terminal extension. European journal of biochemistry 173(3):547-54
  10. Ref:6706903: Fusauchi Y, Iwai K (1984) Tetrahymena histone H2A. Acetylation in the N-terminal sequence and phosphorylation in the C-terminal sequence. Journal of biochemistry 95(1):147-54
  11. Ref:6885734: Fusauchi Y, Iwai K (1983) Tetrahymena histone H2A. Isolation and two variant sequences. Journal of biochemistry 93(6):1487-97

Sequences

>TTHERM_00790790(coding)
ATGTCAACAACTGGTAAGGGAGGAAAAGCTAAAGGTAAAACCGCTTCATCCAAGCAAGTC
TCTAGATCCGCTAGAGCTGGTTTACAATTCCCCGTCGGTAGAATTTCCAGATTCTTGAAG
CACGGTAGATACTCTGAAAGAGTTGGTACTGGTGCTCCCGTCTACTTGGCTGCCGTCTTA
GAATACTTGGCTGCTGAAGTTCTTGAATTGGCTGGTAACGCTGCTAAGGACAACAAGAAG
ACCAGAATCGTCCCCAGACACATTTTATTGGCCATCAGAAACGATGAAGAATTAAATAAA
CTCATGGCTAACACTACTATTGCTGATGGTGGTGTCTTACCCAACATTAACCCCATGCTC
TTGCCCTCTAAGTCCAAGAAGACTGAATCTAGAGGTCAAGCTTCTCAAGACCTTTGA


>TTHERM_00790790(protein)
MSTTGKGGKAKGKTASSKQVSRSARAGLQFPVGRISRFLKHGRYSERVGTGAPVYLAAVL
EYLAAEVLELAGNAAKDNKKTRIVPRHILLAIRNDEELNKLMANTTIADGGVLPNINPML
LPSKSKKTESRGQASQDL


>TTHERM_00790790(gene)
ATGTCAACAACTGGTAAGGGAGGAAAAGCTAAAGGTAAAACCGCTTCATCCAAGCAAGTC
TCTAGATCCGCTAGAGCTGGTTTACAATTCCCCGTCGGTAGAATTTCCAGATTCTTGAAG
CACGGTAGATACTCTGAAAGAGTTGGTACTGGTGCTCCCGTCTACTTGGCTGCCGTCTTA
GAATACTTGGCTGCTGAAGTTCTTGAATTGGCTGGTAACGCTGCTAAGGACAACAAGAAG
ACCAGAATCGTCCCCAGACACATTTTATTGGCCATCAGAAACGATGAAGAATTAAATAAA
CTCATGGCTAACACTACTATTGCTGATGGTGGTGTCTTACCCAACATTAACCCCATGCTC
TTGCCCTCTAAGTCCAAGAAGACTGAATCTAGAGGTCAAGCTTCTCAAGACCTTTGA