Identifiers and Description

Gene Model Identifier

TTHERM_00158520

Standard Name

HSP82 (Heat Shock Protein )

Aliases

PreTt28442 | 13.m00537 | 3829.m01257

Description

Hsp90 family member; 82 kDa heat shock-inducible protein; found in heat shock induced cytosolic hetero-oligomeric complexes with tubulin and hsp73; localizes to mature basal bodies and cortical cytoskeleton; involved in cortical patterning

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Biological Process

Domains

  • ( PF00183 ) Hsp90 protein
  • ( PF06908 ) Protein of unknown function (DUF1273)
  • ( PF02518 ) ATPase, histidine kinase-, DNA gyrase

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 12.1%

TetraMine Data

TTHERM_00158520

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Stentor CoeruleusSteCoe_142950
WormBaseWBGene000009159.997093137033517e-262locus:daf-21 Heat shock prot
ein 90 status:Confirmed Un
iProt:Q18688 protein_id:CAA9
9793.1
Tetrahymena borealisEI9_05309.19.997093137033517e-262hsp90-like protein (705 aa)
DictyBaseDDB_G02674009.997093137033517e-262hspD on chromosome: 1 position
1280990 to 1283391
OxytrichaContig17274.0.g469.997093137033517e-262Hsp90 protein
SGDYPL240C9.997093137033517e-262HSP82 Hsp90 chaperone required
for pheromone signaling and n
egative regulation of Hsf1p; d
ocks with Tom70p for mitochond
rial preprotein delivery; prom
otes telomerase DNA binding an
d nucleotide addition; interac
ts with Cns1p, Cpr6p, Cpr7p, S
ti1p

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:25588944: Woehrer SL, Aronica L, Suhren JH, Busch CJ, Noto T, Mochizuki K (2015) A Tetrahymena Hsp90 co-chaperone promotes siRNA loading by ATP-dependent and ATP-independent mechanisms. The EMBO journal 34(4):559-77
  2. Ref:15154550: Ketola T, Laakso J, Kaitala V, Airaksinen S (2004) Evolution of Hsp90 expression in Tetrahymena thermophila (Protozoa, Ciliata) populations exposed to thermally variable environments. Evolution; international journal of organic evolution 58(4):741-8
  3. Ref:12095102: Frankel J, Williams NE, Nelsen EM, Keeling PJ (2002) An evaluation of Hsp90 as a mediator of cortical patterning in Tetrahymena. The Journal of eukaryotic microbiology 48(2):147-60
  4. Ref:9247200: Williams NE, Nelsen EM (1997) HSP70 and HSP90 homologs are associated with tubulin in hetero-oligomeric complexes, cilia and the cortex of Tetrahymena. Journal of cell science 110 ( Pt 14)( ):1665-72
  5. Ref:SUPR000166

Sequences

>TTHERM_00158520(protein)
MSQQAEHFAFEADIQQLMGLIINTFYSNKEIFLRELISNASDALDKIRYISITDSEKAKL
EVEPNFRIRIIPDKANNTLTLWDTGIGMTKKELINNLGTIAKSGTKAFMEALSSGADISM
IGQFGVGFYSAYLVAEKVEVISKSNDDESQWRWESSAGGTFTVVNDDENPEKLTRGTKII
LHMKNDNLEFLEERRIKDLIKKHSEFIAFPIELQVEKTEEKEETDEEDEEKEKEDKEKTD
EPEIKEETEKKDKKKKKVKVVHTEFEEQNKNKPLWMRKPEEITKEEYVNFYKSLTNDWEE
HQAVKQFSVEGQLEFRAILFIPKRAPFDLFETKKKKNNIKLYVRRVFIMDDCEELIPEYL
NFIKGVVDSEDLPLNISREFLQHNKILKVIKKNIVKKCLDLIQEVADNEEDFKKFYEQFG
KNLKLGIHEDSANREKLSSFLRYHSSKSGEELTTLKDYVSRMKEGQKDIFFITGESRAAV
AASPFVESLRKRGYEVLYMVDPIDEYVIQQLKEYDGKKLKNCSKEGLELEQTEDEKKKFE
EKKAAYEPLCKQIKEVLGDKVEKVVVGQRLDESPCVLVTGEYGWSANMERIMKAQALRDA
SMSTYMISKKTMEINPDNAIVQELKTRSDKDKADKTVKDLIWLLFETSLLTSGFSLDDPS
SFANRIHRMIKLGLQLDDSHIDEEVPGLSQEAEKTENTNNAMEDVD


>TTHERM_00158520(coding)
ATGTCTCAACAAGCTGAACACTTTGCTTTCGAAGCCGATATCCAACAATTGATGGGTTTG
ATCATCAACACTTTCTACTCCAACAAGGAAATTTTCTTGAGAGAATTGATTTCCAATGCC
TCCGATGCTTTGGATAAGATTAGATACATTTCCATCACCGACAGCGAAAAAGCCAAGTTA
GAAGTTGAACCTAACTTCAGAATTAGAATCATTCCCGATAAGGCCAACAATACCCTTACC
CTCTGGGATACCGGTATTGGTATGACCAAGAAGGAATTGATCAACAACTTGGGTACTATC
GCTAAGTCTGGTACCAAGGCCTTCATGGAAGCCCTCTCCAGTGGTGCTGATATTTCTATG
ATTGGTCAATTCGGTGTCGGTTTTTACTCTGCTTACTTGGTTGCCGAAAAGGTCGAAGTT
ATCTCCAAGTCCAACGATGATGAATCCCAATGGAGATGGGAATCCTCTGCTGGTGGTACT
TTCACCGTCGTCAACGATGATGAAAACCCTGAAAAGCTCACCAGAGGTACCAAGATCATC
CTCCACATGAAGAACGATAACTTAGAATTCTTAGAAGAAAGAAGAATCAAGGACTTGATC
AAGAAGCACTCTGAATTCATTGCTTTCCCCATCGAATTATAAGTTGAAAAGACCGAAGAA
AAGGAAGAAACCGACGAAGAAGATGAAGAAAAGGAAAAGGAAGATAAGGAAAAGACCGAT
GAACCCGAAATTAAGGAAGAAACCGAAAAGAAGGACAAGAAGAAAAAGAAAGTTAAAGTT
GTCCACACTGAATTCGAAGAATAAAACAAGAACAAGCCTCTTTGGATGAGAAAGCCCGAA
GAAATCACCAAGGAAGAATACGTTAACTTCTACAAGTCCCTCACCAACGATTGGGAAGAA
CACTAAGCTGTCAAGCAATTCTCCGTTGAAGGTCAACTCGAATTCAGAGCTATCCTCTTC
ATCCCCAAGAGAGCTCCCTTCGACTTATTCGAAACCAAGAAGAAGAAAAACAACATCAAG
CTCTACGTCAGAAGAGTCTTCATTATGGATGACTGCGAAGAACTCATCCCCGAATATCTT
AACTTCATTAAGGGTGTTGTTGATTCTGAAGATCTCCCTCTTAACATCTCCAGAGAATTC
CTCCAACACAACAAGATCCTCAAGGTCATCAAGAAGAACATCGTCAAGAAGTGCCTCGAC
CTTATCCAAGAAGTTGCTGATAACGAAGAAGACTTCAAGAAGTTCTACGAACAATTCGGT
AAGAACCTCAAGCTCGGTATCCACGAAGACTCTGCCAACAGAGAAAAGCTCTCTTCCTTC
CTCAGATATCACTCCTCCAAGTCTGGTGAAGAATTAACCACCCTCAAGGACTACGTCTCC
AGAATGAAAGAAGGTCAAAAGGACATTTTCTTCATTACTGGTGAATCCAGAGCTGCTGTT
GCTGCTTCTCCCTTCGTTGAAAGCCTTAGAAAGAGAGGTTATGAAGTCCTTTACATGGTT
GACCCCATCGATGAATACGTCATCCAACAATTAAAGGAATACGACGGTAAGAAACTCAAG
AACTGCTCCAAGGAAGGTCTTGAACTCGAATAAACTGAAGATGAAAAGAAGAAGTTCGAA
GAAAAGAAGGCTGCCTACGAACCTCTTTGCAAGCAAATCAAGGAAGTCCTCGGTGACAAG
GTCGAAAAGGTCGTCGTTGGTCAAAGACTCGACGAATCTCCTTGCGTCCTCGTTACTGGT
GAATACGGCTGGTCCGCCAATATGGAAAGAATCATGAAGGCTCAAGCTCTCAGAGATGCT
TCCATGTCCACATATATGATCTCCAAGAAGACCATGGAAATCAATCCCGATAACGCCATC
GTCTAAGAACTCAAGACCAGATCCGACAAGGACAAGGCTGACAAGACCGTCAAGGATCTC
ATCTGGTTACTCTTCGAAACCTCCCTCCTCACTTCTGGTTTCTCCCTCGATGACCCCTCT
TCTTTCGCTAACAGAATCCACAGAATGATTAAGCTTGGTCTCCAATTGGACGACTCTCAC
ATTGATGAAGAAGTTCCCGGACTTAGCCAAGAAGCTGAAAAGACTGAAAACACCAACAAC
GCTATGGAAGATGTTGATTGA


>TTHERM_00158520(gene)
ATGTCTCAACAAGCTGAACACTTTGCTTTCGAAGCCGATATCCAACAATTGATGGGTTTG
ATCATCAACACTTTCTACTCCAACAAGGAAATTTTCTTGAGAGAATTGATTTCCAATGCC
TCCGATGCTTTGGATAAGATTAGATACATTTCCATCACCGACAGCGAAAAAGCCAAGTTA
GAAGTTGAACCTAACTTCAGAATTAGAATCATTCCCGATAAGGCCAACAATACCCTTACC
CTCTGGGATACCGGTATTGGTATGACCAAGAAGGAATTGATCAACAACTTGGGTACTATC
GCTAAGTCTGGTACCAAGGCCTTCATGGAAGCCCTCTCCAGTGGTGCTGATATTTCTATG
ATTGGTCAATTCGGTGTCGGTTTTTACTCTGCTTACTTGGTTGCCGAAAAGGTCGAAGTT
ATCTCCAAGTCCAACGATGATGAATCCCAATGGAGATGGGAATCCTCTGCTGGTGGTACT
TTCACCGTCGTCAACGATGATGAAAACCCTGAAAAGCTCACCAGAGGTACCAAGATCATC
CTCCACATGAAGAACGATAACTTAGAATTCTTAGAAGAAAGAAGAATCAAGGACTTGATC
AAGAAGCACTCTGAATTCATTGCTTTCCCCATCGAATTATAAGTTGAAAAGACCGAAGAA
AAGGAAGAAACCGACGAAGAAGATGAAGAAAAGGAAAAGGAAGATAAGGAAAAGACCGAT
GAACCCGAAATTAAGGAAGAAACCGAAAAGAAGGACAAGAAGAAAAAGAAAGTTAAAGTT
GTCCACACTGAATTCGAAGAATAAAACAAGAACAAGCCTCTTTGGATGAGAAAGCCCGAA
GAAATCACCAAGGAAGAATACGTTAACTTCTACAAGTCCCTCACCAACGATTGGGAAGAA
CACTAAGCTGTCAAGCAATTCTCCGTTGAAGGTCAACTCGAATTCAGAGCTATCCTCTTC
ATCCCCAAGAGAGCTCCCTTCGACTTATTCGAAACCAAGAAGAAGAAAAACAACATCAAG
CTCTACGTCAGAAGAGTCTTCATTATGGATGACTGCGAAGAACTCATCCCCGAATATCTT
AACTTCATTAAGGGTGTTGTTGATTCTGAAGATCTCCCTCTTAACATCTCCAGAGAATTC
CTCCAACACAACAAGATCCTCAAGGTCATCAAGAAGAACATCGTCAAGAAGTGCCTCGAC
CTTATCCAAGAAGTTGCTGATAACGAAGAAGACTTCAAGAAGTTCTACGAACAATTCGGT
AAGAACCTCAAGCTCGGTATCCACGAAGACTCTGCCAACAGAGAAAAGCTCTCTTCCTTC
CTCAGATATCACTCCTCCAAGTCTGGTGAAGAATTAACCACCCTCAAGGACTACGTCTCC
AGAATGAAAGAAGGTCAAAAGGACATTTTCTTCATTACTGGTGAATCCAGAGCTGCTGTT
GCTGCTTCTCCCTTCGTTGAAAGCCTTAGAAAGAGAGGTTATGAAGTCCTTTACATGGTT
GACCCCATCGATGAATACGTCATCCAACAATTAAAGGAATACGACGGTAAGAAACTCAAG
AACTGCTCCAAGGAAGGTCTTGAACTCGAATAAACTGAAGATGAAAAGAAGAAGTTCGAA
GAAAAGAAGGCTGCCTACGAACCTCTTTGCAAGCAAATCAAGGAAGTCCTCGGTGACAAG
GTCGAAAAGGTCGTCGTTGGTCAAAGACTCGACGAATCTCCTTGCGTCCTCGTTACTGGT
GAATACGGCTGGTCCGCCAATATGGAAAGAATCATGAAGGCTCAAGCTCTCAGAGATGCT
TCCATGTCCACATATATGATCTCCAAGAAGACCATGGAAATCAATCCCGATAACGCCATC
GTCTAAGAACTCAAGACCAGATCCGACAAGGACAAGGCTGACAAGACCGTCAAGGATCTC
ATCTGGTTACTCTTCGAAACCTCCCTCCTCACTTCTGGTTTCTCCCTCGATGACCCCTCT
TCTTTCGCTAACAGAATCCACAGAATGATTAAGCTTGGTCTCCAATTGGACGACTCTCAC
ATTGATGAAGAAGTTCCCGGACTTAGCGTAAGCTTTTTGAATTTTTTAAATATTTCTCAA
ATTTCTCAATTAATTAATTTGTAATATTCTAATTCTAAATCCTATTTTTTATTAAATAAT
AGCAAGAAGCTGAAAAGACTGAAAACACCAACAACGCTATGGAAGATGTTGATTGA