Identifiers and Description

Gene Model Identifier

TTHERM_00105110

Standard Name

HSP70 (Heat Shock Protein )

Aliases

PreTt23013 | 7.m00462 | hsp70 | HSP70A

Description

Putative 70-kDa heat-shock protein (hsp70); two forms of hsp70 associate with tubulin, mitochondrial hsp70 associates with 14-nm filament protein (14FP), hsp70 proteins have evolutionarily conserved roles in folding nascent polypeptides

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( TIGR01312 ) xylulokinase
  • ( PF06723 ) MreB/Mbl protein
  • ( PF00012 ) DnaK family protein
  • ( TIGR02350 ) chaperone protein DnaK
  • ( TIGR01174 ) cell division protein FtsA
  • ( TIGR00679 ) HPr(Ser) kinase/phosphatase
  • ( TIGR00071 ) tRNA pseudouridine synthase A
  • ( PF07050 ) Protein of unknown function (DUF1333)
  • ( TIGR01991 ) Fe-S protein assembly chaperone HscA
  • ( TIGR00904 ) cell shape determining protein, MreB/Mrl
  • ( TIGR02529 ) ethanolamine utilization protein EutJ family

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 11.9%

TetraMine Data

TTHERM_00105110

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Stentor CoeruleusSteCoe_9940
WormBaseWBGene000020059.997093137033517e-262locus:hsp-1 Heat shock 70 kD
a protein A status:Confirmed
UniProt:P09446 protein_id
:CAB02319.1
Tetrahymena borealisEI9_00354.19.997093137033517e-262dnaK protein (656 aa)
DictyBaseDDB_G02691449.997093137033517e-262hspB on chromosome: 1 position
4410084 to 4412006
OxytrichaContig18685.0.g309.997093137033517e-262Hsp70 protein
SGDYER103W9.997093137033517e-262SSA4 Heat shock protein that i
s highly induced upon stress;
plays a role in SRP-dependent
cotranslational protein-membra
ne targeting and translocation
; member of the HSP70 family;
cytoplasmic protein that conce
ntrates in nuclei upon starvat
ion

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:25586926: Fukuda Y, Akematsu T, Attiq R, Tada C, Nakai Y, Pearlman RE (2015) Role of the Cytosolic Heat Shock Protein 70 Ssa5 in the Ciliate Protozoan Tetrahymena thermophila. The Journal of eukaryotic microbiology 62(4):481-93
  2. Ref:18055912: Barchetta S, La Terza A, Ballarini P, Pucciarelli S, Miceli C (2008) Combination of two regulatory elements in the Tetrahymena thermophila HSP70-1 gene controls heat shock activation. Eukaryotic cell 7(2):379-86
  3. Ref:17959197: Smith DG, Gawryluk RM, Spencer DF, Pearlman RE, Siu KW, Gray MW (2007) Exploring the mitochondrial proteome of the ciliate protozoon Tetrahymena thermophila: direct analysis by tandem mass spectrometry. Journal of molecular biology 374(3):837-63
  4. Ref:17189490: Xie R, Clark KM, Gorovsky MA (2007) Endoplasmic reticulum retention signal-dependent glycylation of the Hsp70/Grp170-related Pgp1p in Tetrahymena. Eukaryotic cell 6(3):388-97
  5. Ref:11260259: Takeda T, Yoshihama I, Numata O (2001) Identification of Tetrahymena hsp60 as a 14-nm filament protein/citrate synthase-binding protein and its possible involvement in the oral apparatus formation. Genes to cells : devoted to molecular & cellular mechanisms 6(2):139-49
  6. Ref:9247200: Williams NE, Nelsen EM (1997) HSP70 and HSP90 homologs are associated with tubulin in hetero-oligomeric complexes, cilia and the cortex of Tetrahymena. Journal of cell science 110 ( Pt 14)( ):1665-72
  7. Ref:8102139: Soares H, Galego L, Cóias R, Rodrigues-Pousada C (1993) The mechanisms of tubulin messenger regulation during Tetrahymena pyriformis reciliation. The Journal of biological chemistry 268(22):16623-30
  8. Ref:8102520: Hendrick JP and Hartl FU (1993) Molecular chaperone functions of heat-shock proteins. Annu Rev Biochem 62:349-84
  9. Ref:8357830: Amaral MD, Galego L, Rodrigues-Pousada C (1993) Heat-shock-induced protein synthesis is responsible for the switch-off of hsp70 transcription in Tetrahymena. Biochimica et biophysica acta 1174(2):133-42
  10. Ref:2663194: Martindale DW, Gu ZM, Csank C (1989) Isolation and complete sequence of the yeast isoleucyl-tRNA synthetase gene (ILS1). Current genetics 15(2):99-106
  11. Ref:SUPR000175

Sequences

>TTHERM_00105110(coding)
ATGGCTGACAAGAAAGCTGAAGGTGGTATCGGTATCGGTATCGATTTAGGTACTACTTAC
TCCTGCGTTGGTGTTTTCATTAACGACAGAGTTGAAATCATTGCTAACGATTAAGGTAAC
AGAACCACTCCCTCTTACGTTGCATTCACCGAAACTGAAAGACTTATTGGTGATGCCGCC
AAGAACTAAGTTGCTAGAAATCCTACCAACACCGTTTTTGATGCCAAGAGACTTATCGGT
AGAAAGTTCAATGAAACCGTCGTCCAAAAGGATATCAAGTTATGGCCCTTCAAGGTTGAA
GCTGGTCCTGATGACAAGCCCAAGATCGTCGTTAAGCACAAAGGTGAAGTCAAGAAGTTC
CACGCTGAAGAAATCTCTTCCATGGTTCTCGTTAAGATGAGAGAAATCGCTGAAGCCTTC
TTGACCAAGTAAATCAAGAACGCCGTCATTACCGTCCCTGCTTACTTCAATGACTCCCAA
AGACAAGCTACCAAGGATGCTGGTGCCATCGCTGGTTTGAACGTTTTGAGAATCATCAAC
GAACCCACTGCCGCCGCTATTGCTTACGGTTTGGACAAGAAGGGTCAAGGTGAAAAGAAC
GTCCTCATCTTCGATTTGGGTGGTGGTACTTTCGATGTCTCCCTCCTTACTCTTGATGAC
GGTATCTTCGAAGTCAAGGCCACTGCTGGTGATACTCACTTGGGTGGTGAAGATTTCGAT
AACAAGCTCGTCGAATTCTGCGCTGCTGACTTCTTAAAGAAGAAGAACATCGATATCAGA
GAAAACCCCAGAGCCATGAGAAGATTAAGAACTCAATGCGAAAGAGCTAAAAGAATTCTT
TCTTCTTCTGCTCAAGCCACCATCGAAGTCGATGCTTTGGCTGATTCCGAAGATTTCATG
ATGGTCATCTCCAGACCCAAATTCGAAGAATTATGTCTTTCTATGTTCAAGGAATGTATC
CCCCCTGTCGAAAAGGTCCTCAAGGACTCCGGTATGGCCAAGAACCAAGTCCACGAAGTC
GTCCTCGTCGGTGGTTCCACTCGTATCCCCAAGGTCATCCAACTCATTACCGAATTCTTC
AACGGTAAGGAACCCAACAGATCCATCAACCCCGATGAAGCCGTCGCTTACGGTGCTGCC
ATTCAAGCTGCTATCTTGACTGGTTCTGGTTCTGAACACATCCAAGACGTCCTTCTTCTC
GACGTTACCCCTCTTTCCATGGGTATCGAAACTGCTGGTCAAGTCATGACTGTCTTGATC
CCCAGAAACACCACCATCCCCACCAAGAAGTCCCAAGTCTTCACCACTTATGCTGATAAC
CAACCTGGTGTCCTCATTCAAGTCTTCGAAGGTGAAAGACCCATGACCAAGGATAACCAT
CTCTTGGGTAAGTTCAACCTCGACGGTATTGCCCCTGCTCCCAGAGGTGTTCCTCAAATC
GAAGTCTCCTTCGATATTGATGAAAACGGTATCCTCAACGTTACTGCCACTGATAAGGGT
ACTTCCAAGTCCAACAAGATTACCATCACCAACCAAAAGGGTAGATTATCCCAAGATGAA
ATCGACAGACTTATCAAGGAAGCTGAAAAATTCAAGGGTGAAGATGAAGCCTTAAAGAAG
AAGGTTGAAGCCAAGAACGGTCTTGAAAACTACACCTACTCCATCAGAAACTCCCTTAAG
GACGAAAAGCTTAAGGACAAGTTCTCTGCTGAAGAAAGAGAAAAGGTTCAAAAGCTCGTC
GACGAAACCTCCAAGTGGCTCGAAGAAAACCACAATGCTGAAGCTGAAGAATACAGCCAC
AAGCAAAAGGCTTTGGAAGAAGTCTTCAACCCCATCATGATGAGAGTCTACCAATCTACT
GGTGGTGTTCCCCCTGGTGCTGATATGGGTGGTGCTGGTTTCCCTGGCAGCGGCTCTGCT
CCCACTGGTGGTGCCTCCAACGTCGATGAAGTCGATTGA


>TTHERM_00105110(protein)
MADKKAEGGIGIGIDLGTTYSCVGVFINDRVEIIANDQGNRTTPSYVAFTETERLIGDAA
KNQVARNPTNTVFDAKRLIGRKFNETVVQKDIKLWPFKVEAGPDDKPKIVVKHKGEVKKF
HAEEISSMVLVKMREIAEAFLTKQIKNAVITVPAYFNDSQRQATKDAGAIAGLNVLRIIN
EPTAAAIAYGLDKKGQGEKNVLIFDLGGGTFDVSLLTLDDGIFEVKATAGDTHLGGEDFD
NKLVEFCAADFLKKKNIDIRENPRAMRRLRTQCERAKRILSSSAQATIEVDALADSEDFM
MVISRPKFEELCLSMFKECIPPVEKVLKDSGMAKNQVHEVVLVGGSTRIPKVIQLITEFF
NGKEPNRSINPDEAVAYGAAIQAAILTGSGSEHIQDVLLLDVTPLSMGIETAGQVMTVLI
PRNTTIPTKKSQVFTTYADNQPGVLIQVFEGERPMTKDNHLLGKFNLDGIAPAPRGVPQI
EVSFDIDENGILNVTATDKGTSKSNKITITNQKGRLSQDEIDRLIKEAEKFKGEDEALKK
KVEAKNGLENYTYSIRNSLKDEKLKDKFSAEEREKVQKLVDETSKWLEENHNAEAEEYSH
KQKALEEVFNPIMMRVYQSTGGVPPGADMGGAGFPGSGSAPTGGASNVDEVD


>TTHERM_00105110(gene)
ATGGCTGACAAGAAAGCTGAAGGTGGTATCGGTATCGGTATCGATTTAGGTACTACTTAC
TCCTGCGTTGGTGTTTTCATTAACGACAGAGTTGAAATCATTGCTAACGATTAAGGTAAC
AGAACCACTCCCTCTTACGTTGCATTCACCGAAACTGAAAGACTTATTGGTGATGCCGCC
AAGAACTAAGTTGCTAGAAATCCTACCAACACCGTTTTTGATGCCAAGAGACTTATCGGT
AGAAAGTTCAATGAAACCGTCGTCCAAAAGGATATCAAGTTATGGCCCTTCAAGGTTGAA
GCTGGTCCTGATGACAAGCCCAAGATCGTCGTTAAGCACAAAGGTGAAGTCAAGAAGTTC
CACGCTGAAGAAATCTCTTCCATGGTTCTCGTTAAGATGAGAGAAATCGCTGAAGCCTTC
TTGACCAAGTAAATCAAGAACGCCGTCATTACCGTCCCTGCTTACTTCAATGACTCCCAA
AGACAAGCTACCAAGGATGCTGGTGCCATCGCTGGTTTGAACGTTTTGAGAATCATCAAC
GAACCCACTGCCGCCGCTATTGCTTACGGTTTGGACAAGAAGGGTCAAGGTGAAAAGAAC
GTCCTCATCTTCGATTTGGGTGGTGGTACTTTCGATGTCTCCCTCCTTACTCTTGATGAC
GGTATCTTCGAAGTCAAGGCCACTGCTGGTGATACTCACTTGGGTGGTGAAGATTTCGAT
AACAAGCTCGTCGAATTCTGCGCTGCTGACTTCTTAAAGAAGAAGAACATCGATATCAGA
GAAAACCCCAGAGCCATGAGAAGATTAAGAACTCAATGCGAAAGAGCTAAAAGAATTCTT
TCTTCTTCTGCTCAAGCCACCATCGAAGTCGATGCTTTGGCTGATTCCGAAGATTTCATG
ATGGTCATCTCCAGACCCAAATTCGAAGAATTATGTCTTTCTATGTTCAAGGAATGTATC
CCCCCTGTCGAAAAGGTCCTCAAGGACTCCGGTATGGCCAAGAACCAAGTCCACGAAGTC
GTCCTCGTCGGTGGTTCCACTCGTATCCCCAAGGTCATCCAACTCATTACCGAATTCTTC
AACGGTAAGGAACCCAACAGATCCATCAACCCCGATGAAGCCGTCGCTTACGGTGCTGCC
ATTCAAGCTGCTATCTTGACTGGTTCTGGTTCTGAACACATCCAAGACGTCCTTCTTCTC
GACGTTACCCCTCTTTCCATGGGTATCGAAACTGCTGGTCAAGTCATGACTGTCTTGATC
CCCAGAAACACCACCATCCCCACCAAGAAGTCCCAAGTCTTCACCACTTATGCTGATAAC
CAACCTGGTGTCCTCATTCAAGTCTTCGAAGGTGAAAGACCCATGACCAAGGATAACCAT
CTCTTGGGTAAGTTCAACCTCGACGGTATTGCCCCTGCTCCCAGAGGTGTTCCTCAAATC
GAAGTCTCCTTCGATATTGATGAAAACGGTATCCTCAACGTTACTGCCACTGATAAGGGT
ACTTCCAAGTCCAACAAGATTACCATCACCAACCAAAAGGGTAGATTATCCCAAGATGAA
ATCGACAGACTTATCAAGGAAGCTGAAAAATTCAAGGGTGAAGATGAAGCCTTAAAGAAG
AAGGTTGAAGCCAAGAACGGTCTTGAAAACTACACCTACTCCATCAGAAACTCCCTTAAG
GACGAAAAGCTTAAGGACAAGTTCTCTGCTGAAGAAAGAGAAAAGGTTCAAAAGCTCGTC
GACGAAACCTCCAAGTGGCTCGAAGAAAACCACAATGCTGAAGCTGAAGAATACAGCCAC
AAGCAAAAGGCTTTGGAAGAAGTCTTCAACCCCATCATGATGAGAGTCTACCAATCTACT
GGTGGTGTTCCCCCTGGTGCTGATATGGGTGGTGCTGGTTTCCCTGGCAGCGGCTCTGCT
CCCACTGGTGGTGCCTCCAACGTCGATGAAGTCGATTGA