Identifiers and Description

Gene Model Identifier

TTHERM_00338240

Standard Name

HSP62 (Heat Shock Protein 60-2)

Aliases

PreTt06065 | 34.m00302 | 3689.m00098

Description

TCP-1/cpn60 chaperonin family protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( TIGR02348 ) chaperonin GroL
  • ( PF00118 ) TCP-1/cpn60 chaperonin family
  • ( TIGR00072 ) hydrogenase maturation protease
  • ( TIGR02345 ) T-complex protein 1, eta subunit
  • ( TIGR02341 ) T-complex protein 1, beta subunit
  • ( TIGR02347 ) T-complex protein 1, zeta subunit
  • ( TIGR02340 ) T-complex protein 1, alpha subunit
  • ( TIGR02342 ) T-complex protein 1, delta subunit
  • ( TIGR02344 ) T-complex protein 1, gamma subunit
  • ( TIGR02346 ) T-complex protein 1, theta subunit
  • ( TIGR02343 ) T-complex protein 1, epsilon subunit
  • ( TIGR02339 ) thermosome, various subunits, archaeal

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00338240

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_15126.19.997093137033517e-262TCP-1/cpn60 chaperonin family
protein (554 aa)
SGDYLR259C3.000328303707556e-126HSP60 Tetradecameric mitochond
rial chaperonin required for A
TP-dependent folding of precur
sor polypeptides and complex a
ssembly; prevents aggregation
and mediates protein refolding
after heat shock; role in mtD
NA transmission; phosphorylate
d
OxytrichaContig13694.0.g57.9987533182317575e-115TCP-1/cpn60 chaperonin family
WormBaseWBGene000020252.0007666164339447e-112locus:hsp-60 Chaperonin homo
log Hsp-60, mitochondrial st
atus:Confirmed UniProt:P5014
0 protein_id:CCD73746.1
DictyBaseDDB_G02881811.0000198575659891e-106hspA on chromosome: 5 position
1238068 to 1240089
Stentor CoeruleusSteCoe_72137.667648073722e-53

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00338240(coding)
ATGATTTCAAAATTCGCAAAATCCATTTACAATTATGGGACAACATCAGTTATTTTTGGA
AAAAATGCTAGAGATGAAATTATCAAAGGCATTCAAACTCTTAATAAAGCTACTTCTTCC
ACCTTAGGACCAAAAGGAAGGAATGTTTGCATAGAAAATGAATTAAGACTACCACGTATT
ACTAAAGATGGTGTGACTGTTGCAAAAAATGTTATGTTTAAAAGCAAACTATAAGAAATA
GGAGCATCTCTCTTGAGAAAAGCTTCAGGATCAACTAATGTTCATGCTGGAGATGGAACC
ACAAGTACAATAATTATAGCTGAAGCAATCTTAAGGGAGAGTAGCAGATTTTTAGAGTAT
AAAGCCAATCCAATTGAAATGAAAAAAGGCATGGATAAAGCAAGAAAGCACATAGTTGAG
TTTTTAAATGAAATATCGATACCAATAGAAACAAAAGACCAGCTCTACAAAGTAGCTATG
GTATCTACCAACTATGATAGTGAAATGTCTAGCTTAATATCTAATGCACTATGGGAGGTA
GGTGTTGATGGCTTAATAGAAATTGAACCAGGAAACCAATTAAAAAATGAATTATTTTTT
GTTAATGGAGCTACATTAAATAGAGGCTTTGCATCAAGAGAATTCATAGTAAATAAATCT
TAAAATAAAGTTGAATAAAGCTATCCTTTAATTTTAGTTGCTAATTTTCCAATTTAGAAA
ATAAAAGAAGTTGTTCCTGCCCTTGAATTAGCAAAGAAGCTAAACAAGCCACTTTTTATT
ATAGCAGAGGATATAAGCAATGAAGTTATTTCAAATCTAATTTTTAATTAATTGAAGGGT
ATAATTGAGTGCTGTGCTATTACTGTACCAGGAATGGGAGCTTTTTCTAAAAATATTCTT
GAAGATATTTCTCTGTTGACTGGTGCTAAATTATTTGATTAGAATAACTATTCAGAATTT
ATAAATTTAAAAGAGAGAGATTTTGGAAAGTGCTAAAAAATCTAATGCTCTGAATTAGAA
ACATTTTTTTCTGGAAGTTATGGAGATAAGAATCTAATTGATAAAAAAATTGAAGAGCTA
CAAATGTAGATGAAGGATTCAAGTGAAACTTCTAAAAAAATTTATAAAGACAGATTAGCT
AGATTATCAGGAAAGATGGCAAAAATAATGTGTGGAGGAAATACTGAGTTTGATATATTT
GAGAATAGAGACAGATTGGTTGATGGGTTAAATGCTGTTAAGAATGCTCTAAAGAGCGGT
ATTCTTCCTGGTGGTGGCATTTGTATGATAAGGGCATCATAGCTATTAGATTATGTTGAA
GTAGATAACGAAGAACAGCAATATGGTATAGATATTCTTAAAAAAGCTCTTTTATAACCT
ACTATAACATTGTTGGAAAATGCTGGGAAAAATGGAAGAGTAGTGGTTGAAAAAATTAAA
GAGCTTTCTTTAGAAGATCCATATGTAGGCTATGATGTAAACACAGATGAGTACATAAAT
TTAACTGAAAGAGGTATCTTTGATTCATTGATTGTTGCAAAAACTACTATTGAAGATTCT
ATTAGTGTGGCATCTATGATTCTTACAACAGAAGTTGCAATTATTAAAGATTACACATAT
GAAGCTCCTAAGTATAATACATACAGAAGAGAAATATTTTGA


>TTHERM_00338240(protein)
MISKFAKSIYNYGTTSVIFGKNARDEIIKGIQTLNKATSSTLGPKGRNVCIENELRLPRI
TKDGVTVAKNVMFKSKLQEIGASLLRKASGSTNVHAGDGTTSTIIIAEAILRESSRFLEY
KANPIEMKKGMDKARKHIVEFLNEISIPIETKDQLYKVAMVSTNYDSEMSSLISNALWEV
GVDGLIEIEPGNQLKNELFFVNGATLNRGFASREFIVNKSQNKVEQSYPLILVANFPIQK
IKEVVPALELAKKLNKPLFIIAEDISNEVISNLIFNQLKGIIECCAITVPGMGAFSKNIL
EDISLLTGAKLFDQNNYSEFINLKERDFGKCQKIQCSELETFFSGSYGDKNLIDKKIEEL
QMQMKDSSETSKKIYKDRLARLSGKMAKIMCGGNTEFDIFENRDRLVDGLNAVKNALKSG
ILPGGGICMIRASQLLDYVEVDNEEQQYGIDILKKALLQPTITLLENAGKNGRVVVEKIK
ELSLEDPYVGYDVNTDEYINLTERGIFDSLIVAKTTIEDSISVASMILTTEVAIIKDYTY
EAPKYNTYRREIF


>TTHERM_00338240(gene)
ATGATTTCAAAATTCGCAAAATCCATTTACAATTATGGGACAACATCAGTTATTTTTGGA
AAAAATGCTAGAGATGAAATTATCAAAGGCATTCAAACTCTTAATAAAGCTACTTCTTCC
ACCTTAGGACCAAAAGTATATTTTTTTATAATAGTAGAAGATAGACCTATTAATTTAATT
ATAATTAATTCTTTTTCATATAGGGAAGGAATGTTTGCATAGAAAATGAATTAAGACTAC
CACGTATTACTAAAGATGGTGTGACTGTTGCAAAAAATGTTATGTTTGTAATTATTAATA
TGCATTAAATATTTTAAATTCTTCTTAATTTATTCAATCTAATCATACATTTTATGTAGA
AAAGCAAACTATAAGAAATAGGAGCATCTCTCTTGAGAAAAGCTTCAGGATCAACTAATG
TTCATGCTGGAGATGGAACCACAAGTACAATAATTATAGCTGAAGCAATCTTAAGGTATA
TAAATGTCTATTTTATTAGACACTTTTAATTATTTTTTTGATATTCCTCTGACTGAATTT
GCATCGATACTAATTATAGAGAGAGAGAATTTGTAGTTTAATTAAGATAATTATAATATT
ATATTATTATATGATTCTAGATAATTCTCATTATTAAATTATCAAAAATATGATAAAATT
ATTTTTTTAACAGGGAGAGTAGCAGATTTTTAGAGTATAAAGCCAATCCAATTGAAATGA
AAAAAGGCATGGATAAAGCAAGAAAGCACATAGTTGAGTTTTTAAATGAAATATCGATAC
CAATAGAAACAAAAGACCAGCTCTACAAAGTAGCTATGGTATCTACCAACTATGATAGTG
AAATGTCTAGCTTAATATCTAATGCACTATGGGAGGTAGGTGTTGATGGCTTAATAGAAA
TTGAACCAGGAAACCAATTAAAAAATGAATTATTTGTAAACAGCTTAAGTATATTATAAT
AAAGCATTTATTTATATAATTTCTATTGTAAAGTTTGTTAATGGAGCTACATTAAATAGA
GGCTTTGCATCAAGAGAATTCATAGTAAATAAATCTTAAAATAAGTAAGTAAACTACTAT
TTTTATAAAAAAATGCTAAATATAATTTAAAAACAGAGTTGAATAAAGCTATCCTTTAAT
TTTAGTTGCTAATTTTCCAATTTAGAAAATAAAAGAAGTTGTTCCTGCCCTTGAATTAGT
AACGTTAAATAAAAATCTATTTTTAAACTAACACAATTAAATTTATTTAAGGCAAAGAAG
CTAAACAAGCCACTTTTTATTATAGCAGAGGATATAAGCAATGAAGTTATTTCAAATCTA
ATTTTTAATTAATTGAAGGGTATAATTGAGGTAAAATAAATATATAAATAAATAAATTTA
TTTTCTGGTTATTTATAAAACTATTTTACCTAAATTATTAATTAAGTGCTGTGCTATTAC
TGTACCAGGAATGGGAGCTTTTTCTAAAAATATTCTTGAAGATATTTCTCTGTTGACTGG
TGCTAAATTATTTGATTAGAATAACTATTCAGAATTTATAAATTTAAAAGAGAGAGATTT
TGGTAAATATTTCTGCTAGAGTTTAATGACATTAAAATTTATTTATTAATAGGAAAGTGC
TAAAAAATCTAATGCTCTGAATTAGAAACATTTTTTTCTGGAAGTTATGGAGATAAGAAT
CTAATTGATAAAAAAATTGAAGAGCTACAAATGTAGATGAAGGATTCAAGTGAAACTTCT
AAAAAAATTTATAAAGACAGATTAGCTAGATTATCAGGAAAGATGGCAAAAATAATGTGT
GGAGGAAATACTGAGTTTGATATATTTGAGAATAGAGACAGATTGGTTGATGGGTTAAAT
GCTGTTAAGAATGCTCTAAAGAGCGTATTTGTGTTATTTAACTAATTTTTAAAGTTTAAA
ATGTCTTTTATTTAATCATAAGGGTATTCTTCCTGGTGGTGGCATTTGTATGATAAGGGC
ATCATAGCTATTAGATTATGTTGAAGTAGATAACGAAGAACAGCAATATGGTATAGATAT
TCTTAAAAAAGCTCTTTTATAACCTACTATAACATTGTTGGAAAATGCTGGGAAAAATGG
AAGAGTAGTGGTTGAAAAAATTAAAGAGCTTTCTTTAGAAGATCCATATGTAGGCTATGA
TGTAAACACAGGTAATTTTTAATTATCATCTAATAAAAAATAATTTTGCAAATGTAAAAA
CTTAACATAAATTTAGATGAGTACATAAATTTAACTGAAAGAGGTATCTTTGATTCATTG
ATTGTTGCAAAAACTACTATTGAAGATTCTATTAGTGTGGCATCTATGATTCTTACAACA
GAAGTTGCAATTATTAAAGATTACACATATGAAGGTATAACTCAAAATTAATTAATTTTA
TTTAAGAATTAATTTACATTTTTAATTTTAAAAATAGCTCCTAAGTATAATACATACAGA
AGAGAAATATTTTGA