Identifiers and Description

Gene Model Identifier

TTHERM_00770690

Standard Name

HSP10 (Heat Shock Protein 10)

Aliases

PreTt13911 | 127.m00074

Description

chaperonin, 10 kDa family protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00770690

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_05633.12.9997246065828143e-59chaperonin, family protein (10
2 aa)
OxytrichaContig98.0.0.g993.0000451088882257e-25Chaperonin 10 Kd subunit
WormBaseWBGene000212481.9994498063102785e-22status:Confirmed UniProt:Q96
5Q1 protein_id:CCD73751.1
SGDYOR020C4.0009493637353324e-18HSP10 Mitochondrial matrix co-
chaperonin that inhibits the A
TPase activity of Hsp60p, a mi
tochondrial chaperonin; involv
ed in protein folding and sort
ing in the mitochondria; 10 kD
heat shock protein with simil
arity to E. coli groES
Stentor CoeruleusSteCoe_247980.0000000001026187963170189
DictyBaseDDB_G02882650.0000009995106777214876DDB_G0288265 on chromosome: 5
position 1314543 to 1315018

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00770690(coding)
ATGACCTCCGTCTTCAAGAGATTAGTTCCCACCTTCAACAGAATCCTCGTTAAGAAGTTC
GAAGCTGAAACCAAGACTAGAACTGGTATCATCCTCTAAGACCCTGCTGATAAGACTGCC
TATGGTGAAATTGTTTCTGCTGGTCCTGGTAACTTTGACAACAATGGTAAGGTTATTCCT
TTGGGCGTTAAAGTTGGTGATATAGTTGTCTTACCCGACTACGGTGGTTCCAAGATTAAT
TTAAAGGATGGTGAATTCTTTGTTTACAGAGATACTGATATCCTCGGTGTTCTCCACAAG
AATTGA


>TTHERM_00770690(protein)
MTSVFKRLVPTFNRILVKKFEAETKTRTGIILQDPADKTAYGEIVSAGPGNFDNNGKVIP
LGVKVGDIVVLPDYGGSKINLKDGEFFVYRDTDILGVLHKN


>TTHERM_00770690(gene)
ATGACCTCCGTCTTCAAGAGATTAGTTCCCACCTTCAACAGAATCCTCGTTAAGAAGTTC
GAAGCTGAAACCAAGACTAGAACTGGTATCATCCTCTAAGACCCTGCTGATAAGACTGCC
TATGGTGAAATTGTTTCTGCTGGTCCTGGTAATTAATTATCATTAGAATTTAGTTTTATA
ACAACAAACAAATATAGCACTTAAGAAACTTAAGAAGCAGCAAAATATGAATCAAACTCA
AGATTAAATCAATATCATTTTTAATTATTAACATTTTAATATAATAGGTAACTTTGACAA
CAATGGTAAGGTTATTCCTTTGGGCGTTAAAGTTGGTGATATAGTTGTCTTACCCGACTA
CGGTGGTTCCAAGATTAATTTAAAGGATGGTGAATTCTTTGTTTACAGAGATACTGATAT
CCTCGGTGTTCTCCACAAGAATTGA