Identifiers and Description

Gene Model Identifier

TTHERM_00444670

Standard Name

HSC82 (Heat Shock Protein)

Aliases

PreTt03835 | 51.m00201 | 3704.m00057

Description

Hsp90 protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( PF00183 ) Hsp90 protein
  • ( TIGR00042 ) non-canonical purine NTP pyrophosphatase, rdgB/HAM1
  • ( PF02518 ) ATPase, histidine kinase-, DNA gyrase

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00444670

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Stentor CoeruleusSteCoe_181460
WormBaseWBGene000114809.997093137033517e-262locus:enpl-1 status:Confirme
d UniProt:Q22235 protein_i
d:CAA92973.1
Tetrahymena borealisEI9_10887.19.997093137033517e-262hsp90-like protein (794 aa)
DictyBaseDDB_G02674009.997093137033517e-262hspD on chromosome: 1 position
1280990 to 1283391
OxytrichaContig7273.0.g459.997093137033517e-262Hsp90 protein
SGDYMR186W9.997093137033517e-262HSC82 Cytoplasmic chaperone of
the Hsp90 family, redundant i
n function and nearly identica
l with Hsp82p, and together th
ey are essential; expressed co
nstitutively at 10-fold higher
basal levels than HSP82 and i
nduced 2-3 fold by heat shock

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00444670(coding)
ATGAGAGTTTAATTAAAAAGCTTCATATTGTTGTTGATGATTGTTCTTCAACAACATGTT
ACTGTAATTAGGGCTGCCGAATAAGGTGTAGAAGAATTTGAATTCTAGACTGAAGTTGGT
CGTCTTATGGATATTATCATTAACTCACTTTATACCTAAAAAGAAATTTTCTTAAGAGAA
TTAATTTCTAACTCTTCTGATGCTTTGGATAAACTCCGTTTCTTGTCTGTTAAGGACCCT
AAGCTCACTGAAGATTTCAAGAACCTTGAAATCTACGTTGACTTCGATGCTGAAAAGAAA
ACCATTTCCATTACCGATACTGGTATTGGTATGACTAAGCAAGATCTTATCCAAAACTTG
GGTACTATCGCTAAGTCTGGTACCACTAACTTCATCGAAGCCATTAAAGGTGGTAATGTC
AACATCATTGGTCAATTTGGTGTCGGTTTCTACAGTTCTTTCTTGGTTGCCTAAAAGGTT
TAAGTTAGCTCTAAGCACCCTGAAGATGAACAATGGGTTTGGGAAAGTAGCGCTGCTAAC
TCATTCCATGTTTTTAAGGAGACTGAATAACTCTTATAAAGAGGTACTCGTGTTACCCTT
TTCTTAAAGCAAGATGCTTAAGAATTCTTAGATGAAAAGAAGTTAGGTGAACTTATTAAG
AGACACTCTGAATTCATTAACTTCCCTATTAACTTGAGACACTTCAAGGAAGTAGAAAAA
GAAGTTGTTGATGAAGAAGCTGAAGCTAAGAGAGCTGAAGAAAAGGCTGCTAAGACTGAT
GAAGAAATCAACGAAGAAACCGATGAAAAGCCTATCATGAAGAAAATCAAGGAAAAGGTC
CCTGAATGGAAGGTTATGAATGACAACAAGGCTATTTGGACTCGTCCTAAGGAAGAAATT
TCTGATGAAGATTACGTCTAATTCTACAAGAGTTTCTCTAAGGATTACGAAGATCCCCTT
AACTGGATTCATTTCAAGGGTGAAGGTGAAGTCGAATTCACTTCTCTTCTTTATTGTCCT
AAGAAGGCTCCTCATGATTTATTCGAAAACTACTATGGTAAGTCTGCTGCCTTAAAGCTT
TACGTCAGAAGAGTACTTATCAATGAAGAATTCGAAGAACTCATGCCCAGATACTTAAAT
TTCATTAGAGGTGTTGTAGATTCTGATGATCTTCCCCTTAATGTCAACAGAGAAAGTATC
CAATAAGTTAAAATGCTTAAGGTTATGAGCAGAAAGCTTGTTAGAAAAGCTCTTGATATG
ATCAAAAAGATGGCTGATGAAGAAGGTGGTGATGATTCTGAAGATGAAGATGACTCTGAA
GAATCCCATGAAGAAGAAGTCAAGCAAAAGGAACCTAAGGAAGGTGAATAACACTCTGAA
GATGATGATGATGAAAAGGGAGAAGATAAAGAAAAGCTCACCCAAGAAAGAAGAGATCGT
TACAAAGCTTTCTGGAAGGAGTTCGGTAAAAATATCAAGCTTGGTATAATTGAAGATTCC
TCCAACAGAAACAAGTTAGCTAAGTTAACAAGATGGTACTCTTCTCATAACTCTACTGAA
TTAACTTCATTTGACTAATACATCAGCAGAGCTAAGGAAAACTAAGACAGCATCTACTTC
TTAGCTGGTGAAACTAAGGAAATTATCTTGAACCACCCTACCATTCAAAAGTTACTCAAG
AAAGGTTATGAAGTCCTTTTACTTGATGATCCTATTGATGAATTCACATTCTAAAACTTG
AATGAATATGAAAAGAAGAAACTCGTTAATGTTGGTAAGGGTAACTTCAAATTCCCTGAA
GACAACGAAACTGAAAGAAAGAGAAATAAAGCTGTCAAGAAGGCTTTCGAACCTTTGACT
TCATGGTGGAAGAAATTATTAACCAACGATTTAGACGAAGTCAGAATCTCTCAAAGATTA
CACGATGATCCTTGCGTCATTGTTTCCAGCGAACATGGTTACTCTGCCTAAATGGAAAGA
ATTTCTAAGGCTTAAGCTTATGCTAACCAAGATAGATCTAACCCTGCTGCCAACCAAAAG
AAGATCCTTGAAATTAATCCTAACCATCCAGCTATTAAGGAACTCCTTGAAAGAGTTAAG
GAAGATCCTGATTCATAAACTGAAGAAATCGCAAACGTCCTTTACGAAGGAGCTTTGGTT
AACTCTGGTTACTCTCTCAAGGACCCTGCTGGTTTTGCCAAGAAATTCTACAGACTTTTA
AATAACGCTCTTGGTATTCCTAAGGACGCTCCTATCGAAGAATATGAAGTCGATATTGAA
GATGATGAAGAAGAAGCTAAATCTGATAGCCAAACTCAATCTGATGAAAATGTAGACATC
GATGATAATGGTAACGATTAACAAGAAGTTAAAGACGATTTGTGA


>TTHERM_00444670(protein)
MRVQLKSFILLLMIVLQQHVTVIRAAEQGVEEFEFQTEVGRLMDIIINSLYTQKEIFLRE
LISNSSDALDKLRFLSVKDPKLTEDFKNLEIYVDFDAEKKTISITDTGIGMTKQDLIQNL
GTIAKSGTTNFIEAIKGGNVNIIGQFGVGFYSSFLVAQKVQVSSKHPEDEQWVWESSAAN
SFHVFKETEQLLQRGTRVTLFLKQDAQEFLDEKKLGELIKRHSEFINFPINLRHFKEVEK
EVVDEEAEAKRAEEKAAKTDEEINEETDEKPIMKKIKEKVPEWKVMNDNKAIWTRPKEEI
SDEDYVQFYKSFSKDYEDPLNWIHFKGEGEVEFTSLLYCPKKAPHDLFENYYGKSAALKL
YVRRVLINEEFEELMPRYLNFIRGVVDSDDLPLNVNRESIQQVKMLKVMSRKLVRKALDM
IKKMADEEGGDDSEDEDDSEESHEEEVKQKEPKEGEQHSEDDDDEKGEDKEKLTQERRDR
YKAFWKEFGKNIKLGIIEDSSNRNKLAKLTRWYSSHNSTELTSFDQYISRAKENQDSIYF
LAGETKEIILNHPTIQKLLKKGYEVLLLDDPIDEFTFQNLNEYEKKKLVNVGKGNFKFPE
DNETERKRNKAVKKAFEPLTSWWKKLLTNDLDEVRISQRLHDDPCVIVSSEHGYSAQMER
ISKAQAYANQDRSNPAANQKKILEINPNHPAIKELLERVKEDPDSQTEEIANVLYEGALV
NSGYSLKDPAGFAKKFYRLLNNALGIPKDAPIEEYEVDIEDDEEEAKSDSQTQSDENVDI
DDNGNDQQEVKDDL


>TTHERM_00444670(gene)
ATGAGAGTTTAATTAAAAAGCTTCATATTGTTGTTGATGATTGTTCTTCAACAACATGTT
ACTGTAATTAGGGCTGCCGAATAAGGTGTAGAAGAATTTGAATTCTAGACTGAAGTTGGT
CGTCTTATGGATATTATCATTAACTCACTTTATACCTAAAAAGAAATTTTCTTAAGAGAA
TTAATTTCTAACTCTTCTGATGCTTTGGATAAACTCCGTTTCTTGTCTGTTAAGGACCCT
AAGCTCACTGAAGATTTCAAGAACCTTGAAATCTACGTTGACTTCGATGCTGAAAAGAAA
ACCATTTCCATTACCGATACTGGTATTGGTATGACTAAGCAAGATCTTATCCAAAACTTG
GGTACTATCGCTAAGTCTGGTACCACTAACTTCATCGAAGCCATTAAAGGTAAATTCTTA
TTTAAATTTAATTCAATATTCAAAGAATGTAATCCAGCTATCATGAAACTATTATCAGCT
TCTATTTTTAATAAAATAAACCAAATGATAAGCACCTACTTTACATTATTCTTTAACACA
TCCTTTGTCTATGGTTTAAATATGATTGGATCAATTATAATCAAAATTTTTAAAAATTCA
CATAAAAAAAAAATGTCTGATTAAAAAAAAGAGTTTATTGTAACAATGACATTATGAGTT
TATTGTAAAAGATAATTTTTATAGGACAATGATTGCTTTAGCTTAGCATTTTATTTTTTA
TTTTTTCTGATCATTTTTTTTAAAAAAAGGTGGTAATGTCAACATCATTGGTCAATTTGG
TGTCGGTTTCTACAGTTCTTTCTTGGTTGCCTAAAAGGTTTAAGTTAGCTCTAAGCACCC
TGAAGATGAACAATGGGTTTGGGAAAGTAGCGCTGCTAACTCATTCCATGTTTTTAAGGA
GACTGAATAACTCTTATAAAGAGGTACTCGTGTTACCCTTTTCTTAAAGCAAGATGCTTA
AGAATTCTTAGATGAAAAGAAGTTAGGTGAACTTATTAAGAGACACTCTGAATTCATTAA
CTTCCCTATTAACTTGAGACACTTCAAGGAAGTAGAAAAAGAAGTTGTTGATGAAGAAGC
TGAAGCTAAGAGAGCTGAAGAAAAGGCTGCTAAGACTGATGAAGAAATCAACGAAGAAAC
CGATGAAAAGCCTATCATGAAGAAAATCAAGGAAAAGGTCCCTGAATGGAAGGTTATGAA
TGACAACAAGGCTATTTGGACTCGTCCTAAGGAAGAAATTTCTGATGAAGATTACGTCTA
ATTCTACAAGAGTTTCTCTAAGGATTACGAAGATCCCCTTAACTGGATTCATTTCAAGGG
TGAAGGTGAAGTCGAATTCACTTCTCTTCTTTATTGTCCTAAGAAGGCTCCTCATGATTT
ATTCGAAAACTACTATGGTAAGTCTGCTGCCTTAAAGCTTTACGTCAGAAGAGTACTTAT
CAATGAAGAATTCGAAGAACTCATGCCCAGATACTTAAATTTCATTAGAGGTGTTGTAGA
TTCTGATGATCTTCCCCTTAATGTCAACAGAGAAAGTATCCAATAAGTTAAAATGCTTAA
GGTTATGAGCAGAAAGCTTGTTAGAAAAGCTCTTGATATGATCAAAAAGATGGCTGATGA
AGAAGGTGGTGATGATTCTGAAGATGAAGATGACTCTGAAGAATCCCATGAAGAAGAAGT
CAAGCAAAAGGAACCTAAGGAAGGTGAATAACACTCTGAAGATGATGATGATGAAAAGGG
AGAAGATAAAGAAAAGCTCACCCAAGAAAGAAGAGATCGTTACAAAGCTTTCTGGAAGGA
GTTCGGTAAAAATATCAAGCTTGGTATAATTGAAGATTCCTCCAACAGAAACAAGTTAGC
TAAGTTAACAAGGTAAACTAACAAAAACTATTTATTTATTTATTAATCAATTTCAATCAA
GTTTTTATTTTTTGAATATCAAAACATAAAAACAAATTAGTAAATAAATTATAGCAAGCT
TTTTATTCATTAGCGAATTATCAGAAAAAAGTCAATTAGTTCATCATAAATTAATCAAAA
AAAGATATTTTTTCATAGCAATTTAAATAAAGTTTGATTTAAATAATTAAAAAATAAAAA
AATAACAACAAAAAAATTTACTTGGGAAAAAAAATTAACTGTGGAAAAAAATTTAGAAAA
ATTTTTTTTTTTAAAAATGCTTATTTTATTTTTATTAAAAATTTAATTAATTTAAATTTA
ATAATTTAATTTATAATAAATAAATAGATGGTACTCTTCTCATAACTCTACTGAATTAAC
TTCATTTGACTAATACATCAGCAGAGCTAAGGAAAACTAAGACAGCATCTACTTCTTAGC
TGGTGAAACTAAGGAAATTATCTTGAACCACCCTACCATTCAAAAGTTACTCAAGAAAGG
TTATGAAGTCCTTTTACTTGATGATCCTATTGATGAATTCACATTCTAAAACTTGAATGA
ATATGAAAAGAAGAAACTCGTTAATGTTGGTAAGGGTAACTTCAAATTCCCTGAAGACAA
CGAAACTGAAAGAAAGAGAAATAAAGCTGTCAAGAAGGCTTTCGAACCTTTGACTTCATG
GTGGAAGAAATTATTAACCAACGATTTAGACGAAGTCAGAATCTCTCAAAGATTACACGA
TGATCCTTGCGTCATTGTTTCCAGCGAACATGGTTACTCTGCCTAAATGGAAAGAATTTC
TAAGGCTTAAGCTTATGCTAACCAAGATAGATCTAACCCTGCTGCCAACCAAAAGAAGAT
CCTTGAAATTAATCCTAACCATCCAGCTATTAAGGAACTCCTTGAAAGAGTTAAGGAAGA
TCCTGATTCATAAACTGAAGAAATCGCAAACGTCCTTTACGAAGGAGCTTTGGTTAACTC
TGGTTACTCTCTCAAGGACCCTGCTGGTTTTGCCAAGAAATTCTACAGACTTTTAAATAA
CGCTCTTGGTATTCCTAAGGACGCTCCTATCGAAGAATATGAAGTCGATATTGAAGATGA
TGAAGAAGGTAAATAAATAAATATAATTTAAATATTTTTAAAACTAATTATGATTTTTCT
TATTAAATAGAAGCTAAATCTGATAGCCAAACTCAATCTGATGAAAATGTAGACATCGAT
GATAATGGTAACGATTAACAAGAAGTTAAAGACGATTTGTGA