Identifiers and Description

Gene Model Identifier

TTHERM_00313710

Standard Name

HRT1 (HRT1 (High level expression Reduces Ty3 transposition) ortholog 1)

Aliases

PreTt03558 | 30.m00367 | 3810.m01979

Description

RING finger protein; ubiquitin ligase; involved in ubiquitin proteasome system

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.2%

TetraMine Data

TTHERM_00313710

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_03383.11.0004460510701209e-64RING finger protein (94 aa)
OxytrichaContig254.1.g192.000704504372864e-47RING-H2 zinc finger
DictyBaseDDB_G02876294.000820122464668e-47rbx1 on chromosome: 5 position
496993 to 497681
WormBaseWBGene000043201.999534248571833e-46locus:rbx-1 RING-box protein
1 status:Confirmed UniPro
t:Q23457 protein_id:CAA94801
.1
SGDYOL133W2.9993743585281133e-40HRT1 RING finger containing su
bunit of Skp1-Cullin-F-box ubi
quitin protein ligases (SCF);
required for Gic2p, Far1p, Sic
1p and Cln2p degradation; may
tether Cdc34p (a ubiquitin con
jugating enzyme or E2) and Cdc
53p (a cullin) subunits of SCF
Stentor CoeruleusSteCoe_304951.9287498479639178e-22

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:SUPR000156
  2. Ref:SUPR000217

Sequences

>TTHERM_00313710(coding)
ATGATTGAGTTATTTTTCAGAACAGAAATAGTTCATATAAAGAACAAATAGTAAGAAGCT
TTGATCAAAAAATAAAATATTAGGTACTCAAAATTTATTTATATAAATATTTGTGAAGAA
AGAAAAATTAAATAAATCATAAATAGCTAATAAATTTAAGAGTTTATACTATAAAAAAGA
ATAAGTAAAGATTTAATAAATAAATAAATGGAAACAGAAAAAAGATTCGAAGTCAAAAAA
TGGAACGCTGTTGCTCTTTGGCAATGGGATATTGAAGTTGAAAATTGCGCCATTTGCAAG
AACAACATTATGGAACCTTGTATTGAATGTGATGCCAACTAAAACTCAAATAGTGCTTCC
GAATGTGATGTTGCTTGGGGTACTTGCAATCACGCATTCCATTTCCATTGTATTTCCAGA
TGGTTAAAAACTCGTAATACTTGTCCTCTTGATTCTCGTCAATGGGATTATCAAAGATAT
GGTCGTTGA


>TTHERM_00313710(protein)
MIELFFRTEIVHIKNKQQEALIKKQNIRYSKFIYINICEERKIKQIINSQQIQEFILQKR
ISKDLINKQMETEKRFEVKKWNAVALWQWDIEVENCAICKNNIMEPCIECDANQNSNSAS
ECDVAWGTCNHAFHFHCISRWLKTRNTCPLDSRQWDYQRYGR


>TTHERM_00313710(gene)
ATGATTGAGTTATTTTTCAGAACAGAAATAGTTCATATAAAGAACAAATAGTAAGAAGCT
TTGATCAAAAAATAAAATATTAGGTACTCAAAATTTATTTATATAAATATTTGTGAAGAA
AGAAAAATTAAATAAATCATAAATAGCTAATAAATTTAAGAGTTTATACTATAAAAAAGA
ATAAGTAAAGATTTAATAAATAAATAAATGGAAACAGAAAAAAGATTCGAAGTCAAAAAA
TGGAACGCTGTTGCTCTTTGGCAATGGGATATTGAAGTTGAAAATTGCGCCATTTGCAAG
AAGTAAGTTTAATCATCTCACAACCTTTTTTTATTAAGTGCTTGGCATGTCTTGTTTTAC
ATTAATTAGATTATTTTCAAAGATTTCGTATAAAAATTTTAAAAGCCAAATAGGTTTTAT
AAGCACATAAAATAAAATGTTTAACTATATTTGTAACCATATTTAATTTAAATAATTAGC
AACATTATGGAACCTTGTATTGAATGTGATGCCAACTAAAACTCAAATAGTGCTTCCGAA
TGTGATGTTGCTTGGGGTACTTGCAATCACGCATTCCATTTCCATTGTATTTCCAGATGG
TTAAAAACTCGTAATACTTGTCCTCTTGATTCTCGTCAATGGGATTATCAAAGATATGGT
CGTTGA