Identifiers and Description

Gene Model Identifier

TTHERM_00721830

Standard Name

HRS2 (histidyl-tRNA synthetase 2)

Aliases

PreTt18491 | 115.m00147

Description

histidyl-tRNA synthetase family protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

  • ( PF00617 ) RasGEF domain
  • ( PF03129 ) Anticodon binding domain
  • ( TIGR01225 ) histidine ammonia-lyase
  • ( TIGR00442 ) histidyl-tRNA synthetase
  • ( PF06703 ) Microsomal signal peptidase 25 kDa
  • ( TIGR00443 ) ATP phosphoribosyltransferase, regulatory subunit
  • ( PF00587 ) tRNA synthetase class II core

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10%

TetraMine Data

TTHERM_00721830

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_09477.19.997093137033517e-262histidyl-tRNA synthetase (933
aa)
OxytrichaContig9747.0.g589.997093137033517e-262Histidyl-tRNA synthetase
DictyBaseDDB_G02741591.9990846765523993e-155hisS on chromosome: 2 position
4879244 to 4880801
SGDYPR033C1.999149254372995e-126HTS1 Cytoplasmic and mitochond
rial histidine tRNA synthetase
; efficient mitochondrial loca
lization requires both a prese
quence and an amino-terminal s
equence; mutations in human or
tholog HARS2 are associated wi
th Perrault syndrome
WormBaseWBGene000020014.001709789838121e-126locus:hars-1 Histidine--tRNA
ligase status:Confirmed U
niProt:P34183 protein_id:CAA
93416.2
Stentor CoeruleusSteCoe_321586.375869581278994e-59

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00721830(coding)
ATGGTGAAAATTATAGGTTTAAGAAACTTAAATAGAACTGAAATTCAAGAAGTAGTTTTT
GAAAACGAAGGTATTCAATTAGATGCTACTATTGTTAACGATTTCATATGCGAAACTAAA
GAAGCTCTTTTATCTCTTGATGAAATTAACAAAATAATTGATTTAAATTCTAGCAAATTA
TCATAGGCAATTCTCGATTTGAAGCTCGAGAAGGAAAGCAATTTTTCAAGAGGCTTCTTA
TTCATTCTTTCTTTAGCACTTACTAAGTCCAGAAAGAGCATTCGCAAGTCAACAATCGAA
TTCGTTCTTTCTACATTCAACGCATTTGTCAAGCCATCAGGTCTTTCTGTTAATCCTTAT
AACATTTTGAGAGTATTCTATGGTCAGTAAGGTATTACCGAAGCCTTAACAACTGCTGGA
ATTGCCCCAGTTTAACTTACAAAAGACGAAGTCGAACTTATTCTCTTAAGTGTTCAAAGT
ACATACGTCTCTGCTTTAACTTTATGGAATCTTTTTGGAACAAAGAATGTTTTGAAATTA
GGCAGCGTAAGTTATGCATTCTTCTGCGAAAGTGGCTATATTAACACTGAATAATTCTTA
ACTGCTTATTCAGAAAAGAGAAGCTTACAAAGAAGCATTTCTCTTCTTGCCACTGAAATT
TAAAATTTATTATTCTCCAGCAGACTATCTAAAAAGAAAGCCACTTAAGAAATCACTTCT
TGGATAGAAATTGCAGGCACTGTTAGAAATGGTTTACAATCATTACTTGATTTCTTAGTA
GACGAATTAGCAGTTGAAAGTGATGATGTTAAAATTTAATCTTCAGGAGTTACTAACCAA
ATTGAGTTAAAGAATTTCATGGGTTTGAATAACTTATTAATTTCTTTACTTGGTAGTATC
AGTCTTTAGGCTATCAACACCTTAAATAGAATAGTTTCAAATGCTGGTCTTTTGGAAAAT
AAAGTAAAAACTCTTCTCGCTGAAGTTGTTTCTTATAACTCTTCACTTAATTTCAGTTAT
TTGACTGGCAATTATAAGGCATTAGGTGAAAACTTTATCCTTGCTCTTTAATTCGATAAG
TATATTTCTTATCTTTACCAAGCTATCCAATATGAATTCTTTGTTTCTTATTACACTTTA
CACGCTCTTAACAAGCAACTAAGCGAGAACAAAAAAGGAAAGGAAGATGATAGCAAAAAG
AAGAAGAAAGAAGTTAAGCTTTTGCAATTAGGTAAGGGAACAGAAGTAGTATTCAATGAA
GTTTAAGAAAAGTTTAAAATTGCTGGTGAAGAAAAGTGCTTAGAAGTAGAAGAGAATATC
AGCTAAAACTATTTCAGCTTACACAACAACTAGCTCTTAGCTTAAATCGATGAATTAATT
GCCCCTCGTAATGAAGAAAGACGTAAGCCTAAGATTCCTAAAGGTACAAGAGATTTCAAC
CCTCTTTAAATGGCAATCAAAAGAAAGGTTTTCAAGATCATTTAAGGTATTTTACTTCAA
CACGGTGCTGTTGAAATCGATACTCCTGTTTTTGAACTTAAGGAAACCCTTACTGGTAAG
TATGGTAATGACTCTAAATTGATTTACGATCTTGACGATTAAGGTGGTGAACTCTTATCT
CTTAGATACGATCTTACCGTTCCTTTTGCCCGTTTTCTTGCTACTCAATCTCTTACAAAC
TTCAAGAGATTCCACATTGCCAAGGTCTATAGAAGAGATTAACCTAACATGACTAAGGGA
AGATATAGAGAATTCTATCAATGCGATATCGATATTGCTGGTAATTACGATCCTATGATT
CCTGATGCTGAAATTATTAAGGTCGTCAATGATATTTTATAAGCATTAGAACTCGGCTCT
CCTTTCACTATTAAAGTTAACTCTCGTAAAATTTTGGATGCCATGATTGAGATAGCTGGT
GCTCCTCATTCTAAGTTCAAAACTATTTGTTCTTCAATCGACAAGCTTGATAAGGAACCT
TGGTCAGAAGTTAGAAGAGAATTAATTGAAGACAAAGGTCTTGATGTTGTTATTGTAGAT
AAATTAGGACATTTTGTTTCTTACAAGGGCAAGCCTTTTGAGTTATTATAAAAAATCAAG
GATGACAAATTATTTGATGCTTCCGAAGCTGGTAGATAGGGAGTATAAGAAATGACTCTT
CTTTTCGATTACTTAGAAGCTATGAACTGCCTTTCTAATGTTAGCTTTGATCTCTCATTG
GCAAGAGGACTTGATTACTATACAGGTATGATTTACGAAGCTGTTCTTGAAGGTGCTAAC
ATCGGCTCTATTGGTGGTGGTGGCCGTTATGATGGCTTAGTTGGAATGTTCTCTTCCAAA
TAAATTCCTTCAGTCGGTGGTTCTGTTGGTATTGAACGTGTTTTCAATATTTTGGAAGAA
CAATATAAGAAAAAATTATCAATCAGAGCAACTGAAACAGAATTTTTAGTTTGCACTGTT
GGTAATGGCTTATGCAAAGAAAAACTTAGATTAGTAAACGAAATGTGGGCTCGTGGACTC
AAGACTGAAATTATTTACTCAGAAAAACCTAAACCTAGAAAACAATTAGATTATGCTTAT
GAAAACTAAATTCCTTTCACTATCTGGTTAGGTGAAGAAGAAATTAAGGGAGGCTTTGTC
AAGGTTAAGTGTACCTACACCAAGGTAGAAGAACCTTGTCCAAGAGATAAGCTATTTGAA
ACACTCGAACAAAAACTTGTTCAATACCATGATGATTTAATTAATGATCGTGTTGTTTAT
ACTTATGAAGAAATTAAGGAAAATTGA


>TTHERM_00721830(protein)
MVKIIGLRNLNRTEIQEVVFENEGIQLDATIVNDFICETKEALLSLDEINKIIDLNSSKL
SQAILDLKLEKESNFSRGFLFILSLALTKSRKSIRKSTIEFVLSTFNAFVKPSGLSVNPY
NILRVFYGQQGITEALTTAGIAPVQLTKDEVELILLSVQSTYVSALTLWNLFGTKNVLKL
GSVSYAFFCESGYINTEQFLTAYSEKRSLQRSISLLATEIQNLLFSSRLSKKKATQEITS
WIEIAGTVRNGLQSLLDFLVDELAVESDDVKIQSSGVTNQIELKNFMGLNNLLISLLGSI
SLQAINTLNRIVSNAGLLENKVKTLLAEVVSYNSSLNFSYLTGNYKALGENFILALQFDK
YISYLYQAIQYEFFVSYYTLHALNKQLSENKKGKEDDSKKKKKEVKLLQLGKGTEVVFNE
VQEKFKIAGEEKCLEVEENISQNYFSLHNNQLLAQIDELIAPRNEERRKPKIPKGTRDFN
PLQMAIKRKVFKIIQGILLQHGAVEIDTPVFELKETLTGKYGNDSKLIYDLDDQGGELLS
LRYDLTVPFARFLATQSLTNFKRFHIAKVYRRDQPNMTKGRYREFYQCDIDIAGNYDPMI
PDAEIIKVVNDILQALELGSPFTIKVNSRKILDAMIEIAGAPHSKFKTICSSIDKLDKEP
WSEVRRELIEDKGLDVVIVDKLGHFVSYKGKPFELLQKIKDDKLFDASEAGRQGVQEMTL
LFDYLEAMNCLSNVSFDLSLARGLDYYTGMIYEAVLEGANIGSIGGGGRYDGLVGMFSSK
QIPSVGGSVGIERVFNILEEQYKKKLSIRATETEFLVCTVGNGLCKEKLRLVNEMWARGL
KTEIIYSEKPKPRKQLDYAYENQIPFTIWLGEEEIKGGFVKVKCTYTKVEEPCPRDKLFE
TLEQKLVQYHDDLINDRVVYTYEEIKEN


>TTHERM_00721830(gene)
ATGGTGAAAATTATAGGTTTAAGAAACTTAAATAGAACTGAAATTCAAGAAGTAGTTTTT
GAAAACGAAGGTATTCAATTAGATGCTACTATTGTTAACGATTTCATATGCGAAACTAAA
GAAGCTCTTTTATCTCTTGATGAAATTAACAAAATAATTGATTTAAATTCTAGCAAATTA
TCATAGGCAATTCTCGATTTGAAGCTCGAGAAGGAAAGCAATTTTTCAAGAGGCTTCTTA
TTCATTCTTTCTTTAGCACTTACTAAGTCCAGAAAGAGCATTCGCAAGTCAACAATCGAA
TTCGTTCTTTCTACATTCAACGCATTTGTCAAGCCATCAGGTCTTTCTGTTAATCCTTAT
AACATTTTGAGAGTATTCTATGGTCAGTAAGGTATTACCGAAGCCTTAACAACTGCTGGA
ATTGCCCCAGTTTAACTTACAAAAGACGAAGTCGAACTTATTCTCTTAAGTGTTCAAAGT
ACATACGTCTCTGCTTTAACTTTATGGAATCTTTTTGGAACAAAGTAATTTTATTATCCA
GCTTTAATAATAAATGAAAAAGTATTTAAATGATGGAAACAAACTTACTTTCTAAATTTC
ATAGCAAGGCAATATTTTAGATAATTTAGTGAGATATTTAAATTATTTAATTTAATTGAA
AAATTTTTATTTCAATAATATTGCTTTATTTTTTAGAATAAAATTAAAATTATAAATATT
TTATAGAATATTCTTGTAAAAAAATTATTGTTTAAATTAAATAGGAATGTTTTGAAATTA
GGCAGCGTAAGTTATGCATTCTTCTGCGAAAGTGGCTATATTAACACTGAATAATTCTTA
ACTGCTTATTCAGAAAAGAGAAGCTTACAAAGAAGCATTTCTCTTCTTGCCACTGAAATT
TAAAATTTATTATTCTCCAGCAGACTATCTAAAAAGAAAGCCACTTAAGAAATCACTTCT
TGGATAGAAATTGCAGGCACTGTTAGAAATGGTTTACAGTAATTATAAACTAAATTTTAA
ATACTTTAATTTTAGCAAATTAATTTAGATAATTTACAAATAAACAATTTTATTATAAAA
AAATATAATAAAAATTAAGAATTTATGTCATTTAGATTAAATAATAATAATATCAGTTAT
TATTTATAATATCGCAAATATTTAGCTATAATAAATATTATTTTATTAAATCTTTAAATG
AATAATGGAGATATAAATAATATTGTAGCAAGTAGTTATTGTTGAAAAAAGGATATATCA
TTTATTTTTTAAATATTTATTTTTTTTATTAATTATTAAAAATATTTTGTTTTAACTAAT
GAATAGATCATTACTTGATTTCTTAGTAGACGAATTAGCAGTTGAAAGTGATGATGTTAA
AATTTAATCTTCAGGAGTTACTAACCAAATTGAGTTAAAGAATTTCATGGGTTTGAATAA
CTTATTAATTTCTTTACTTGGTAGTATCAGTCTTTAGGCTATCAACACCTTAAATAGAAT
AGTTTCAAATGCTGGTCTTTTGGAAAATAAAGTAAAAACTCTTCTCGCTGAAGTTGTTTC
TTATAACTCTTCACTTAATTTCAGTTATTTGACTGGCAATTATAAGGCATTAGGTGAAAA
CTTTATCCTTGCTCTTTAATTCGATAAGTATATTTCTTATCTTTACCAAGCTATCCAATA
TGAATTCTTTGTTTCTTATTACACTTTACACGCTCTTAACAAGCAACTAAGCGAGAACAA
AAAAGGAAAGGAAGATGATAGCAAAAAGAAGAAGAAAGAAGTTAAGCTTTTGCAATTAGG
TAAGGGAACAGAAGTAGTATTCAATGAAGTTTAAGAAAAGTTTAAAATTGCTGGTGAAGA
AAAGTGCTTAGAAGTAGAAGAGAATATCAGCTAAAACTATTTCAGCTTACACAACAACTA
GCTCTTAGCTTAAATCGATGAATTAATTGCCCCTCGTAATGAAGAAAGACGTAAGCCTAA
GATTCCTAAAGGTACAAGAGATTTCAACCCTCTTTAAATGGCAATCAAAAGAAAGGTTTT
CAAGATCATTTAAGGTATTTTACTTCAACACGGTGCTGTTGAAATCGATACTCCTGTTTT
TGAACTTAAGGAAACCCTTACTGGTAAGTATGGTAATGACTCTAAATTGATTTACGATCT
TGACGATTAAGGTGGTGAACTCTTATCTCTTAGATACGATCTTACCGTTCCTTTTGCCCG
TTTTCTTGCTACTCAATCTCTTACAAACTTCAAGAGATTCCACATTGCCAAGGTAATTTA
AGAATTATAAAAAGCAGCTTATTATAATATTTGATTTTTTAGGTCTATAGAAGAGATTAA
CCTAACATGACTAAGGGAAGATATAGAGAATTCTATCAATGCGATATCGATATTGCTGGT
AATTACGATCCTATGATTCCTGATGCTGAAATTATTAAGGTCGTCAATGATATTTTATAA
GCATTAGAACTCGGCTCTCCTTTCACTATTAAAGTTAACTCTCGTAAAATTTTGGATGCC
ATGATTGAGATAGCTGGTGCTCCTCATTCTAAGTTCAAAACTATTTGTTCTTCAATCGAC
AAGCTTGATAAGGTAACTAATAATATAGAATTAATGTATTTTTACTAAAATAATAATAAT
AAATAAAAAAATAGGAACCTTGGTCAGAAGTTAGAAGAGAATTAATTGAAGACAAAGGTC
TTGATGTTGTTATTGTAGATAAATTAGGACATTTTGTTTCTTACAAGGGCAAGCCTTTTG
AGTTATTATAAAAAATCAAGGATGACAAATTATTTGATGCTTCCGAAGCTGGTAGATAGG
GAGTATAAGAAATGACTCTTCTTTTCGATTACTTAGAAGCTATGAACTGCCTTTCTAATG
TTAGCTTTGATCTCTCATTGGCAAGAGGACTTGATTACTATACAGGTAAAAAAGCAAATA
AATTTAGTTAAATATCTAAAATATATTTATTTATTTATTAGGTATGATTTACGAAGCTGT
TCTTGAAGGTGCTAACATCGGCTCTATTGGTGGTGGTGGCCGTTATGATGGCTTAGTTGG
AATGTTCTCTTCCAAATAAATTCCTTCAGTCGGTGGTTCTGTTGGTATTGAACGTGTTTT
CAATATTTTGGAAGAACAATATAAGAAAAAATTATCAATCAGAGCAACTGAAACAGAATT
TTTAGTTTGCACTGTTGGTAATGGCTTATGCAAAGAAAAACTTAGATTAGTAAACGAAAT
GTGGGCTCGTGGACTCAAGACTGAAATTATTTACTCAGAAAAACCTAAACCTAGAAAACA
ATTAGATTATGCTTATGAAAACTAAATTCCTTTCACTATCTGGTTAGGTGAAGAAGAAAT
TAAGGGAGGCTTTGTCAAGGTTAAGGTAAAACCTATCACCTTTTTTTAAATTATTTTTTT
GATTAAATAAAGCTTTTTTTATTTTAAAAATAATTATTCTAATTTTTATTTTTAATATTA
AATAGTGTACCTACACCAAGGTAGAAGAACCTTGTCCAAGAGATAAGCTATTTGAAACAC
TCGAACAAAAACTTGTTCAATACCATGATGATTTAATTAATGATCGTGTTGTTTATACTT
ATGAAGAAATTAAGGAAAATTGA