Identifiers and Description

Gene Model Identifier

TTHERM_00401980

Standard Name

HRS1 (histidyl-tRNA synthetase 1)

Aliases

PreTt12743 | 43.m00261 | 3713.m00087

Description

histidyl-tRNA synthetase family protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

  • ( TIGR00442 ) histidyl-tRNA synthetase
  • ( TIGR00443 ) ATP phosphoribosyltransferase, regulatory subunit
  • ( PF00587 ) tRNA synthetase class II core

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 11.1%

TetraMine Data

TTHERM_00401980

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_13986.19.997093137033517e-262histidyl-tRNA synthetase (464
aa)
DictyBaseDDB_G02698223.0008725323024365e-87mhisS on chromosome: 1 positio
n 3669575 to 3671080
Stentor CoeruleusSteCoe_249797.984904245686979e-30
OxytrichaContig9747.0.g587.996806159126539e-24Histidyl-tRNA synthetase
SGDYPR033C3.998609120989657e-17HTS1 Cytoplasmic and mitochond
rial histidine tRNA synthetase
; efficient mitochondrial loca
lization requires both a prese
quence and an amino-terminal s
equence; mutations in human or
tholog HARS2 are associated wi
th Perrault syndrome
WormBaseWBGene000020010.000000000000004001928599951003locus:hars-1 Histidine--tRNA
ligase status:Confirmed U
niProt:P34183 protein_id:CAD
89746.1

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00401980(coding)
ATGTAGAGATTTAGCTCTTTGCAATCTGTTAAGGGAATGAAGGATTTAGTTGGAAATTAG
CTTTTGAAGCATCGATTTATATTTGATTGCGGTGCTAAGGTAATGGAAAAGCATGGGTAC
TAGATGATTGTTTAAAATATTTTAGAGCATAAATAAGTTTTCTCGAGAACTTTAGGAGAT
ACATCTGAAATTATTAATAAAGAAATGTATGGATTTACTGATTAGTCAGGTAAAGAACTT
GTACTTAGACCAGAAGGTACTGCAAGTGTTGTACGTCATATTTTAGAAAATTCAAAGCAC
TTCGAATAGTAGCAGAAATATTATTATTACGGTCCTATGTATAGATATGAGCGCCCTCAA
CTAGGAAGGCAAAGATAATTTTACTAGCTAGGATGTGAATTTTTACATAAAGAGAATCCT
AAAAATAGCTACTTAATAGATGCTGAGATCATTATAGTAGCTCATAAGTTTTTACAAAGG
GTATTGGGCAAACATTCCGAATTTTAAATGGAGATCAATACAATAGGAGATGTTGAAGAC
AGAGTAAAATACAATTCAATTTTAAAAGAATACTATGAAAAAAATATACACAAACTTTCT
GAATTAAGTAAAATGCGCTTAGAAAGAAATAATCCTTTAAGAATATTTGATTCTAAGGAG
GCATAAGATTAAGATTTAATAGCTAATGCTCCTTAATTTTCAGAAAGTATGAAATAAGAA
AGCAAAGAATACTTTAGAAATCTTTTAGAAGTACTAGATTCTCTTAATATTTCTTACAAG
ATAAATCCTTTACTAGTAAGAGGATTAGATTATTACTCACACACTTGCTTTGAAATCAAA
AATGTTGCTCAATAGGGTAAATCTTAAGACACAATCCTGGCAGGTGGCAGATACGATCAT
CTAGCATCAGTTCTTAACTCAAAAGCTACCAACTTAAACGGAGTAGGCTTTGCATGTGGT
ATCGAAAGAATTGGCTTGCTCTTGCAAGACGATGATCCCAAGTTAAAAGAGTTTGAGAAG
AAAAAGATTAAAATAGGAATTGTTCCTGTCCTAGGAAAATAAAATTTAAGTGATGAATTT
GAAAGAAATCTCAAGCTATATTGCGTCAATTTAATGAATTCAATCTCTGATGATTAAATT
GAAGTCTAACTTGTCCTTCATACATCTAAAATGGATAAGTAAATGGAATATTTATTGAAG
AATGAATTCAAATGGGGTATTTTCATTGGCGAAAATGAGGTGAAAGAAAAAAAAGTGAGC
ATAAAAAATTTATTAGATCGCGAAAGTTTTACTATTGAACGTGAGTAGATAAATAATTAC
CAATTTTGA


>TTHERM_00401980(protein)
MQRFSSLQSVKGMKDLVGNQLLKHRFIFDCGAKVMEKHGYQMIVQNILEHKQVFSRTLGD
TSEIINKEMYGFTDQSGKELVLRPEGTASVVRHILENSKHFEQQQKYYYYGPMYRYERPQ
LGRQRQFYQLGCEFLHKENPKNSYLIDAEIIIVAHKFLQRVLGKHSEFQMEINTIGDVED
RVKYNSILKEYYEKNIHKLSELSKMRLERNNPLRIFDSKEAQDQDLIANAPQFSESMKQE
SKEYFRNLLEVLDSLNISYKINPLLVRGLDYYSHTCFEIKNVAQQGKSQDTILAGGRYDH
LASVLNSKATNLNGVGFACGIERIGLLLQDDDPKLKEFEKKKIKIGIVPVLGKQNLSDEF
ERNLKLYCVNLMNSISDDQIEVQLVLHTSKMDKQMEYLLKNEFKWGIFIGENEVKEKKVS
IKNLLDRESFTIEREQINNYQF


>TTHERM_00401980(gene)
ATGTAGAGATTTAGCTCTTTGCAATCTGTTAAGGGAATGAAGGATTTAGTTGGAAAGTAA
TAAATATTTATTACTTTTTCCATTTAAAAATTAAACTATTATAAAACTATAAAGTTAGCT
TTTGAAGCATCGATTTATATTTGATTGCGGTGCTAAGGTAATGGAAAAGCATGGGTACTA
GATGATTGTTTAAAATATTTTAGAGCATAAATAAGTTTTCTCGAGAACTTTAGGAGATAC
ATCTGAAATTATTAATAAAGTAAAAAAAACTTATGCTCTCTTATTTTAATTTAGTCAACT
TTAAATATTCATTTTAAGATTTTTATGAGTATTTTCCTTTTTTTTATATTGTTTCTTAAA
GTTGATAAATTTTGGTTGATTTAATAGATAATTCTAGTTAATTTTTTTGAAATCCATTAA
GATTTTATGTTTTTTTATCTAACCAATTTATGATTCATTTTATAAAAGGAAATGTATGGA
TTTACTGATTAGTCAGGTAAAGAACTTGTACTTAGACCAGAAGGTACTGCAAGTGTTGTA
CGTCATATTTTAGAAAATTCAAAGCACTTCGAATAGTAGCAGAAATATTATTATTACGGT
CCTATGTATAGATATGAGCGCCCTCAACTAGGAAGGCAAAGATAATTTTACTAGCTAGGA
TGTGAATTTTTACATAAAGAGAATCCTAAAAATAGCTACTTAATAGATGCTGAGATCATT
ATAGTAGCTCATAAGTTTTTACAAAGGGTATTGGGCAAACATTCCGAATTTTAAATGGAG
ATCAATACAATAGGAGATGTTGAAGACAGAGTAAAATACAATTCAATTTTAAAAGAATAC
TATGAAAAAAATATACACAAACTTTCTGAATTAAGTAAAATGCGCTTAGAAAGAAATAAT
CCTTTAAGAATATTTGATTCTAAGGAGGCATAAGATTAAGATTTAATAGCTAATGCTCCT
TAATTTTCAGAAAGTATGAAATAAGAAAGCAAAGAATACTTTAGAAATCTTTTAGAAGTA
CTAGATTCTCTTAATATTTCTTACAAGATAAATCCTTTACTAGTAAGAGGATTAGATTAT
TACTCACACACTTGCTTTGAAATCAAAAATGTTGCTCAATAGGGTAAATCTTAAGACACA
ATCCTGGCAGGTGGCAGATACGATCATCTAGCATCAGTTCTTAACTCAAAGTATAATTAA
ATAAAATATTTTTAAATTTTAAATACATTTAATAAAAACCCAAATAAAATCATAGTAGAA
AAAAAATTTAATTTGAAACAATTTAAGTAAATTTGTAAAAAATAATTAGAATTTATGATC
AAAGTTATAAATAACATAAGATTTATTTTTTTAATATTTGCTACAAATACATAATAAATA
AATGGTTGAAATAGCATTTCATTTATATATCAAATTTTTTAAAAATACAAACAGTTATTT
TATTTACTATTAAATAAAATTTTATAAATTAGAAACATTAAATAATATTTCAAATAATTT
TAAATGATTTAATCTAATTTAAATATTCATATTTTATTGTTAATGATTTTGGCTTTTATA
TGGTTTAAGATAAAAAAGATATGAAGATTTTATTTATCTATCTACATTAATTTTATTTAG
GATGTTTTTTATTCTTCTACTAGCACTTTTTTTAGCTATAAGTTGAAATTATATAGAATT
TATTTGGATTAACTATATATTCATTTTCTCCATCATTGCATATGTTGGATTCACCAACAC
TAGAGTATTTTTCCATCTATAGCATTATTTCGGTTTGCTATTAGATTTCTATTTATTACG
ACTATTTTAATACAAGATAGAGGAAAAATAGAACAAGTAGCAAATTCTCCTTCTTTATAT
AAGATATTTTGTTCAATATATAATTGTTTTATGTTCACTTTGTTAAACCACATTTATACA
TTTTAAATTTTATTTTAAATTATAGAGCTACCAACTTAAACGGAGTAGGCTTTGCATGTG
GTATCGAAAGAATTGGCTTGCTCTTGCAAGACGATGATCCCAAGTTAAAAGAGTTTGAGA
AGAAAAAGATTAAAATAGGAATTGTTCCTGTCCTAGGAAAATAAAATTTAAGTGATGAAT
TTGAAAGAAATCTCAAGCTATATTGCGTCAATTTAATGAATTCAATCTCTGATGATTAAA
TTGAAGTCTAACTTGTCCTTCATACATCTAAAATGGATAAGTAAATGGAATATTTATTGA
AGGTAATTACTATTGATATATTATTGAAACTAATTATTGAAAGCAAAAATAGGTTTTAGT
TTTTAAGATGAAGCTTATTTGAAATAGAATGATTTTAAATTTAACATTTTTTGTTTAAAA
TAGAATGAATTCAAATGGGGTATTTTCATTGGCGAAAATGAGGTGAAAGAAAAAAAAGTG
AGCATAAAAAATTTATTAGATCGCGAAAGTTTTACTATTGAACGTGAGTAGATAAATAAT
TACCAATTTTGA