Identifiers and Description

Gene Model Identifier

TTHERM_00551070

Standard Name

HPL7 (Heterochromatin Protein 1 Like 7)

Aliases

PreTt29211 | 72.m00134

Description

heterochromatin protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

  • ( PF06658 ) Protein of unknown function (DUF1168)
  • ( PF00385 ) 'chromo' (CHRromatin Organization MOdifier) domain

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.2%

TetraMine Data

TTHERM_00551070

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_07338.12.0007019863683806e-141heterochromatin protein (422 a
a)
DictyBaseDDB_G02830230.0000009995106777214876hcpA on chromosome: 4 position
170065 to 170742
WormBaseWBGene000019950.000005000363240844623locus:hpl-1 status:Confirmed
UniProt:G5EET5 protein_id
:CAA94152.1
OxytrichaContig9832.0.g370.00003998524687536623Chromo (CHRromatin Organisatio
n MOdifier) domain

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:28692189: Wiley EA, Horrell S, Yoshino A, C Schornak C, Bagnani C, L Chalker D (2017) Diversification of HP1-like Chromo Domain Proteins in Tetrahymena thermophila. The Journal of eukaryotic microbiology ( ):

Sequences

>TTHERM_00551070(coding)
ATGAAAAAGAGAAGACAATCAACAAATAATGAAAAGCAGGAAGATCTTTATGAACCTGAA
AAGATATTAGATAAAAAAGTTAATTAAAGTGGTACTTCCTATTTGGTTAAATGGAAAGGT
TTTAGGGCTTCACAAGCAACATGGGAATTTTATAAAAACATATCTCATTGCAATTGGCTT
TTTGAAGATTGGGAAGAGTAGTAAAATAGAAAGGAATTACAAAAAATCAAGAATATGGAT
AGGATAATAGACAAAAAATATGTAAATAGTAAAGTTTTTTATTTGGTTTCTCTAAAAAAT
GGCGGAGAAGATGTATGGATTAGAAGAAAGGCTTTGATGCTTGACCATGCCGATAAAATT
TCTGAATATGAAAAGAGTGATTAATTGGTTGGGGCTAAAAGAAAATATTAATAGAAAAGA
TTTAGCAAAAGCTAAGATAGATTTCTTAGCAGTGATGAAGATTTGAGCGATTCTTAAAGT
GATAAAAATTCAGATAATAGCTAAAATAATTCAAGCAATAGCGATAATAGTTAAAGTAGA
AGCGGAAGCAGTTCAGATTCATGCAGTAGAAGCTCTTCAGAAGATAATTAAGATGAAAAT
ACAAATTAAAGAGGAAAAAGTAATGGTAGAAGAAAGGGTAGAATTTATAACAATAAAAAA
AAACCGAAGAGAGGAGGAAATAGAAAAAATTAAAAAGGATAGAATATTAATGATTCAAAT
AGTAGCTCAGATGAGAATAGTGAGCAAGAAGTCTCTGAATCAAGAAGAATAGTTAAAACA
AAAAGAAAAATTCCAAAAAAATGCAAAATTTTATATGATAAGCTTCCTTTTTATGGTATA
CTTGGTATAGATGAACCAAAATCTATAAAAAATATGGTCATAGACAAAAGAGTAGGGACG
AAGGATGATGGATATTTTGCTTGTGATATTATTTGGAAAATTAGACCTAATAAACAATAG
CCTGTCGATAGTAGAGTCAGCAGAAAAGATATAAAAGAGTTCTATCCTCTTATTTTAATA
GAATTTTATGAGTATAATATGACATATAATGGTGAAGTAGTCAATGCTGATGATGAAGAT
GACTTAGAATATTACAATGGTGATGATGAAGAAGATGCTGATCATGATGATGAGTATTAT
TAAAAATTATAAAGAAAAGCTGGTAAAAAACCTCTTGAAAACGAAAACTCAGAAGCTGAT
AATTAGGATGAAAAATCTGAAGATTCATTTAGCTTTTAGAATTAGATTTACTATGGGTAT
GCTAAAACTAATGAATAGAAAAAGTATGTTAAATTTGATGAAAAATTCTTCAACAACAAT
CAAATGGAAGAAATGTGA


>TTHERM_00551070(protein)
MKKRRQSTNNEKQEDLYEPEKILDKKVNQSGTSYLVKWKGFRASQATWEFYKNISHCNWL
FEDWEEQQNRKELQKIKNMDRIIDKKYVNSKVFYLVSLKNGGEDVWIRRKALMLDHADKI
SEYEKSDQLVGAKRKYQQKRFSKSQDRFLSSDEDLSDSQSDKNSDNSQNNSSNSDNSQSR
SGSSSDSCSRSSSEDNQDENTNQRGKSNGRRKGRIYNNKKKPKRGGNRKNQKGQNINDSN
SSSDENSEQEVSESRRIVKTKRKIPKKCKILYDKLPFYGILGIDEPKSIKNMVIDKRVGT
KDDGYFACDIIWKIRPNKQQPVDSRVSRKDIKEFYPLILIEFYEYNMTYNGEVVNADDED
DLEYYNGDDEEDADHDDEYYQKLQRKAGKKPLENENSEADNQDEKSEDSFSFQNQIYYGY
AKTNEQKKYVKFDEKFFNNNQMEEM


>TTHERM_00551070(gene)
ATGAAAAAGAGAAGACAATCAACAAATAATGAAAAGCAGGAAGATCTTTATGAACCTGAA
AAGATATTAGATAAAAAAGTTAATTAAAGTGGTACTTCCTATTTGGTTAAATGGAAAGGT
TTTAGGGCTTCACAAGCAACATGGGTAAATACATAAATTTATTTCCATAATTAGAGCTCA
ATAAAAAATGTGTTATTATAAACCAGGAATTTTATAAAAACATATCTCATTGCAATTGGC
TTTTTGAAGATTGGGAAGAGTAGTAAAATAGAAAGGAATTACAAAAAATCAAGAATATGG
ATAGGATAATAGACAAAAAATATGTAAATAGTAAAGTTTTTTATTTGGTTTCTCTAAAAA
ATGGCGGAGAAGATGTATGGATTAGAAGAAAGGCTTTGATGCTTGACCATGCCGATAAAA
TTTCTGAATATGAAAGTAATTATTTTGAAGATTTAAATTTCTTTTACATTTATTTATATT
TGATTTATATAAAGAGAGTGATTAATTGGTTGGGGCTAAAAGAAAATATTAATAGAAAAG
ATTTAGCAAAAGCTAAGATAGATTTCTTAGCAGTGATGAAGATTTGAGCGATTCTTAAAG
TGATAAAAATTCAGATAATAGCTAAAATAATTCAAGCAATAGCGATAATAGTTAAAGTAG
AAGCGGAAGCAGTTCAGATTCATGCAGTAGAAGCTCTTCAGAAGATAATTAAGATGAAAA
TACAAATTAAAGAGGAAAAAGTAATGGTAGAAGAAAGGGTAGAATTTATAACAATAAAAA
AAAACCGAAGAGAGGAGGAAATAGAAAAAATTAAAAAGGATAGAATATTAATGATTCAAA
TAGTAGCTCAGATGAGAATAGTGAGCAAGAAGTCTCTGAATCAAGAAGAATAGTTAAAAC
AAAAAGAAAAATTCCAAAAAAATGCAAAATTTTATATGATAAGCTTCCTTTTTATGGTAT
ACTTGGTATAGATGAACCAAAATCTATAAAAAATATGGTCATAGACAAAAGAGTAGGGAC
GAAGGATGATGGATATTTTGCTTGTGATATTATTTGGAAAATTAGACCTAATAAACAATA
GCCTGTCGATAGTAGAGTCAGCAGAAAAGATATAAAAGAGTTCTATCCTCTTATTTTAAT
AGAATTTTATGAGTATAATATGACATATAATGGTGAAGTAGTCAATGCTGATGATGAAGA
TGACTTAGAATATTACAATGGTGATGATGAAGAAGATGCTGATCATGATGATGAGTATTA
TTAAAAATTATAAAGAAAAGCTGGTAAAAAACCTCTTGAAAACGAAAACTCAGAAGCTGA
TAATTAGGATGAAAAATCTGAAGATTCATTTAGCTTTTAGAATTAGATTTACTATGGGTA
TGCTAAAACTAATGAATAGAAAAAGTATGTTAAATTTGATGAAAAATTCTTCAACAACAA
TCAAATGGAAGAAATGTGA