Identifiers and Description

Gene Model Identifier

TTHERM_00245410

Standard Name

HPL6 (Heterochromatin Protein 1-Like 6)

Aliases

PreTt02436 | 21.m00267

Description

heterochromatin protein 1, putative

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

  • ( PF00385 ) 'chromo' (CHRromatin Organization MOdifier) domain

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.7%

TetraMine Data

TTHERM_00245410

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_00603.16.998985483803218e-56hypothetical protein (377 aa)
OxytrichaContig19010.0.g640.000000009996807949091551Chromo (CHRromatin Organisatio
n MOdifier) domain
WormBaseWBGene000179900.0002999184360822198locus:cec-4 status:Confirmed
UniProt:Q19972 protein_id
:CCD70433.1

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00245410(coding)
ATGAGTGACACAACAACAACAGCAAATTCAAAGAAAAACACCAAAATAAATGGTAAATAA
CAAGGTAGTAAAGATAAGGCTGAGAAGAAAGAGAAGGCTATTAACAAAAAGAAATATGAA
AGCGAAGATGAAGAAGAAGAGGAAGAGGAGGAATTCTACATTGTAGAAAAAATATTAGAT
TATAAAAAGATAAAGAATAGAGATCTATTTTTAGTAAAATGGGAAGGGTACGAAGAGCTA
ACTTGGGAACCCAAATCTAATTTGTCAAATGTAAAGCAACTTGTTGAGAATTTTTTGAAA
ACCTTAAAAGATAAAGGAAAAAAAGAAAATTCTGAAAATCTTGAAAGCTCGAGTGCTTTG
CAAGAAGGGAGTGAATCTAAAAAGCAATAATTAAGCGGTGGAAAGATATAAAAAAAAGAA
GTAAAAAGCCCTATATCTATTAGCAAAGAGAAATAGGCAGAGAAAGTAAAGTAAGATGAA
GGATCTCATTTAAAAAGAGATGTAGAAGATCACCATAATATTTCTATTTCTTCAATGAAG
GGTAAAAAAGATGATGATGGAGAGTAGAATGAAGAACAAGAAAACAAAGTTGTTGTTAAA
TAAGAAGACGTAGATGAGGAAAAGCAAAGCACCAAGAAAAGAGGAGAAGAAGAAGAGGAA
TAGTAATAATAATAAAATAGTAAACAAATAGAGGAGGAAGAAGAAGGTAAAGATGTATAG
AAAGAAAAGAAATAATAGAATGAAGAAAAATAAGATATCAAGCACTTAGAATAAAAAGAA
AGTAAAGAAGACCACGATGCTATATAATAATAATAAAAGAACACTAGTCTCAATAAAAAA
AGAAAGAAAGAAGAATAAAGTTAGGATGATATTGATGAATAAAATGAATAAGATAAACCA
CAAGATAAGGTAAAACACTTACCTGAAATTTTAGGAAATCTTGAAGAACACATTCCTTTA
GAAATATCTAAAGCTGTCTATAAAACATCTAAGTTTTAGTATCTAGTTTAGTGGAAGTAG
CAATAAGGCATTAAAATTATACCCAGTTTTATTTTCTCTGACGATTTATTAAAAAGATAT
AGTGATCTCATAGTACATTTTTATGAAGACAAAGCCTTAAAAAGAAAGTGA


>TTHERM_00245410(protein)
MSDTTTTANSKKNTKINGKQQGSKDKAEKKEKAINKKKYESEDEEEEEEEEFYIVEKILD
YKKIKNRDLFLVKWEGYEELTWEPKSNLSNVKQLVENFLKTLKDKGKKENSENLESSSAL
QEGSESKKQQLSGGKIQKKEVKSPISISKEKQAEKVKQDEGSHLKRDVEDHHNISISSMK
GKKDDDGEQNEEQENKVVVKQEDVDEEKQSTKKRGEEEEEQQQQQNSKQIEEEEEGKDVQ
KEKKQQNEEKQDIKHLEQKESKEDHDAIQQQQKNTSLNKKRKKEEQSQDDIDEQNEQDKP
QDKVKHLPEILGNLEEHIPLEISKAVYKTSKFQYLVQWKQQQGIKIIPSFIFSDDLLKRY
SDLIVHFYEDKALKRK


>TTHERM_00245410(gene)
ATGAGTGACACAACAACAACAGCAAATTCAAAGAAAAACACCAAAATAAATGGTAAATAA
CAAGGTAGTAAAGATAAGGCTGAGAAGAAAGAGAAGGCTATTAACAAAAAGAAATATGAA
AGCGAAGATGAAGAAGAAGAGGAAGAGGAGGAATTCTACATTGTAGAAAAAATATTAGAT
TATAAAAAGATAAAGAATAGAGATCTATTTTTAGTAAAATGGGAAGGGTACGAAGAGCTA
ACTTGGGAACCCAAATCTAATTTGTCAAATGTAAAGCAACTTGTTGAGAATTTTTTGAAA
ACCTTAAAAGATAAAGGAAAAAAAGAAAATTCTGAAAATCTTGAAAGCTCGAGTGCTTTG
CAAGAAGGGAGTGAATCTAAAAAGCAATAATTAAGCGGTGGAAAGATATAAAAAAAAGAA
GTAAAAAGCCCTATATCTATTAGCAAAGAGAAATAGGCAGAGAAAGTAAAGTAAGATGAA
GGATCTCATTTAAAAAGAGATGTAGAAGATCACCATAATATTTCTATTTCTTCAATGAAG
GGTAAAAAAGATGATGATGGAGAGTAGAATGAAGAACAAGAAAACAAAGTTGTTGTTAAA
TAAGAAGACGTAGATGAGGAAAAGCAAAGCACCAAGAAAAGAGGAGAAGAAGAAGAGGAA
TAGTAATAATAATAAAATAGTAAACAAATAGAGGAGGAAGAAGAAGGTAAAGATGTATAG
AAAGAAAAGAAATAATAGAATGAAGAAAAATAAGATATCAAGCACTTAGAATAAAAAGAA
AGTAAAGAAGACCACGATGCTATATAATAATAATAAAAGAACACTAGTCTCAATAAAAAA
AGAAAGAAAGAAGAATAAAGTTAGGATGATATTGATGAATAAAATGTAATTTTTTAAAAT
TTTTAATTATTTAAATTCAAATTCAAACAAAAAGGAATAAGATAAACCACAAGATAAGGT
AAAACACTTACCTGAAATTTTAGGAAATCTTGAAGAACACATTCCTTTAGAAATATCTAA
AGCTGTCTATAAAACATCTAAGTTTTAGTATCTAGTTTAGTGGAAGTAGCAATAAGGCAT
TAAAATTATACCCAGTTTTATTTTCTCTGACGATTTATTAAAAAGATATAGTGATCTCAT
AGTACATTTTTATGAAGACAAAGCCTTAAAAAGAAAGTGA