Identifiers and Description

Gene Model Identifier

TTHERM_00585190

Standard Name

HPL5 (Heterochromatin Protein 1 Like 5)

Aliases

PreTt04125 | 80.m00171 | 3675.m00069 | HPC_SH | COI13

Description

chromo domain protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

  • ( PF00410 ) ribosomal protein S8
  • ( PF00385 ) 'chromo' (CHRromatin Organization MOdifier) domain

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.4%

TetraMine Data

TTHERM_00585190

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_15192.11.9991517704232713e-32hypothetical protein (755 aa)
WormBaseWBGene000019960.00020003864201578029locus:hpl-2 status:Confirmed
UniProt:G5EDE2 protein_id
:CAB07241.1

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:25588944: Woehrer SL, Aronica L, Suhren JH, Busch CJ, Noto T, Mochizuki K (2015) A Tetrahymena Hsp90 co-chaperone promotes siRNA loading by ATP-dependent and ATP-independent mechanisms. The EMBO journal 34(4):559-77

Sequences

>TTHERM_00585190(coding)
ATGAATAACAAATATTATCATCAACCTTCCTAAAAATTTGAAATCCTGGCCATATTAGAT
AAAAGGGCAAATCCTAAGAATGGGAAAATAGAATATTTAGTCCAGTGGAAATAATGGCCT
CTAGATTATACATGGGAGCCTAAAAAAAACATTTAAAATTTTATTGATCAAAATGAGTTA
TTTGTTGATGATGAAGACCTTAGGAGACATTATAAGGAAAAGCAATATCGAAGAAAAATC
TTAAGAGAAGAAAGAAATAATTAAGTTGAAAAGATATGCAATAGTATAGTTAATCATACT
TAAATTAATACTACTTAGAATAGATAAAATGATAATGATTTACTTAGTAGTATTGATGAT
TATGAAGAAAATATAATATACGAGGAGAGCTTTGATGAATCGAATTATTAAGAAAACTGC
AAGGAATCATGGAGCACAAATCCGAATACATAATAAACTATTAGGAAAGATGAATTTTTT
TTATAAGAACCTGATAGCTATTCTATGAAAAAGATTTAAAATAAAAAAGAGATTAGTTCA
TTAAAAATAGAAAATACTTTTATCAACTCAAAGGCATAAAAGTTTAATAAATCTTCTTCA
GAAATAGATTTAAGTTAAAATGAAGGATCATAAAAAGTTGATTAAATGAATGAGTACTAA
GTTAATTAAGATAATTTTAAAACTGAGGGATTTTCAGAAGAAAATTTATTTGAAAATAAA
TCTGCTTCCACTGAATAAATTCAATTCTCTAATGCTAATGATAGCTAAAAGCATTAAAAA
ATTGTTAGAAAGTATTCAAATGTGATTTCAAAAGATGAAGAAATCGGAGAATTTATGAAA
GATGAAATTTCAAACATAGAAATGGAAATAAAATATTCATTTAAGGTGAATTGGAAAAGA
AGAAGCAATGGAGTCACTCCATTGTCAAAAACAATAGAAGTTCTTAGTAAAAAGCATATT
TCTCCTTAAGAAATGATTGATTATTTAACTTAATCAAATTAAATTAATAATGAAATAGAT
AAAAGTTAAAAATGA


>TTHERM_00585190(protein)
MNNKYYHQPSQKFEILAILDKRANPKNGKIEYLVQWKQWPLDYTWEPKKNIQNFIDQNEL
FVDDEDLRRHYKEKQYRRKILREERNNQVEKICNSIVNHTQINTTQNRQNDNDLLSSIDD
YEENIIYEESFDESNYQENCKESWSTNPNTQQTIRKDEFFLQEPDSYSMKKIQNKKEISS
LKIENTFINSKAQKFNKSSSEIDLSQNEGSQKVDQMNEYQVNQDNFKTEGFSEENLFENK
SASTEQIQFSNANDSQKHQKIVRKYSNVISKDEEIGEFMKDEISNIEMEIKYSFKVNWKR
RSNGVTPLSKTIEVLSKKHISPQEMIDYLTQSNQINNEIDKSQK


>TTHERM_00585190(gene)
ATGAATAACAAATATTATCATCAACCTTCCTAAAAATTTGAAATCCTGGCCATATTAGAT
AAAAGGGCAAATCCTAAGAATGGGAAAATAGAATATTTAGTCCAGTGGAAATGTATAAAA
AAATTATATTTAAAAATTAAAATAAAAAATATTTTATTTATTTTATTTAGAATGGCCTCT
AGATTATACATGGGAGCCTAAAAAAAACATTTAAAATTTTATTGATCAAAATGAGTTATT
TGTTGATGATGAAGACCTTAGGAGACATTATAAGGAAAAGCAATATCGAAGAAAAATCTT
AAGAGAAGAAAGAAATAATTAAGTTGAAAAGATATGCAATAGTATAGTTAATCATACTTA
AATTAATACTACTTAGAATAGATAAAATGATAATGATTTACTTAGTAGTATTGATGATTA
TGAAGAAAATATAATATACGAGGAGAGCTTTGATGAATCGAATTATTAAGAAAACTGCAA
GGAATCATGGAGCACAAATCCGAATACATAATAAACTATTAGTAATTATTAAATAAAAAA
TTTTAAATATCAAAATAATAATTAATTTTAAAATAATTTTTTAAATTAAGAGAAAAAGTA
TTTATTTTTATTTTTTTTTATTTAGGGAAAGATGAATTTTTTTTATAAGAACCTGATAGC
TATTCTATGAAAAAGATTTAAAATAAAAAAGAGATTAGTTCATTAAAAATAGAAAATACT
TTTATCAACTCAAAGGCATAAAAGTTTAATAAATCTTCTTCAGAAATAGATTTAAGTTAA
AATGAAGGATCATAAAAAGTTGATTAAATGAATGAGTACTAAGTTAATTAAGATAATTTT
AAAACTGAGGGATTTTCAGAAGAAAATTTATTTGAAAATAAATCTGCTTCCACTGAATAA
ATTCAATTCTCTAATGCTAATGATAGCTAAAAGCATTAAAAAATTGTTAGAAAGTATTCA
AATGTGATTTCAAAAGATGAAGAAATCGGAGAATTTATGAAAGATGAAATTTCAAACATA
GAAATGGAAATAAAATATTCATTTAAGGTGAATTGGAAAAGAAGAAGCAATGGAGTCACT
CCATTGTCAAAAACAATAGAAGTTCTTAGTAAAAAGCATATTTCTCCTTAAGAAATGATT
GATTATTTAACTTAATCAAATTAAATTAATAATGAAATAGATAAAAGTTAAAAATGA