Identifiers and Description

Gene Model Identifier

TTHERM_00585180

Standard Name

HPL4 (Heterochromatin Protein 1 Like 4)

Aliases

PreTt04124 | 80.m00170 | 3675.m00068 | HPC

Description

Heterochromatin protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

  • ( PF09311 ) Rab5 binding
  • ( TIGR00288 ) conserved hypothetical protein TIGR00288
  • ( PF00385 ) 'chromo' (CHRromatin Organization MOdifier) domain

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.4%

TetraMine Data

TTHERM_00585180

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_15193.14.997860539111522e-53hypothetical protein (347 aa)
WormBaseWBGene000019960.000005998506718272351locus:hpl-2 status:Confirmed
UniProt:G5EDE2 protein_id
:CAB07241.1

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:28692189: Wiley EA, Horrell S, Yoshino A, C Schornak C, Bagnani C, L Chalker D (2017) Diversification of HP1-like Chromo Domain Proteins in Tetrahymena thermophila. The Journal of eukaryotic microbiology ( ):

Sequences

>TTHERM_00585180(coding)
ATGGAACAATAATAAACAAATTTAGAATACTCTCCTTATATTTTTGAGATTGAGAGCATT
TTGGAAAAGAGAATTCATCCTAAAACAGGAAAAACAGAATTTTTAGTTTAATGGAAATAA
TGGCCAGATGATCCAACATGGGAGCCAGCTTAAAATATCTAAAGCTTTTTAAATAACAAT
AATTAAAAGAAAAAGGAAGATGATTCACATTCTAACTTGAAGCAAAGAAAATTGTAAAAA
ATTGAAGACAAAGTGAAGAGGTCTGAACAAGCAAATAATCAAACTTAGAAGCTAAATGAT
AGCTTGCAATATTTAGATGAATAAATTTAATTTCTTTAAAATAAATACGAGCTTTTTATT
TCAGATTCAGAGACAGAGTAAAAAAAATTAATTCCTGATAAAATAAGCGAAATTGAACCA
GAGTAAATTGAAAATGAAGAAAATACCAATATGATGAATAACGTTTAAATTGAGCCAATC
TATAAAATATTAGACAAATAAGAAGTTGAAAATACTATTTATTATCTTATTCTCTTTTAT
GATGAAAAATTACCTTAATGGGTGAAGTAAGAAAAGCTGATTGGCTATGAAGATGAAATT
TTAGAATATGAAAAACAAATAATTTAAGAGAGCACTGAACTAAACTCTAAATAGTTATTA
GAAACCAGTATATAAAGTATACAAAATGAAAATTTATAAATAGAAAAAGATCAAAAATAA
GAAGAAAATTAATTTAAAAAGGTAATGGATCAAGAAAATCTTGAAAAAAGTAAAAATAAT
TTTAATAGGAATCAACAATTTTAAAATGATATAGATGAAGGTGATTTTTTAACAGATTAA
ATATAAGATATAGAAGCAAACTTTATGTTTACTTATAGTATTAATTGGAAACCGAGAAAA
GATGGAAACATTCCTCTAAATAAATAAGTCTAATTTGTAAAAAAAATTACAATAACGCCA
TAAGAATTCATTGATTAAATCCTATAAAATAAATTTCTTAATTGA


>TTHERM_00585180(protein)
MEQQQTNLEYSPYIFEIESILEKRIHPKTGKTEFLVQWKQWPDDPTWEPAQNIQSFLNNN
NQKKKEDDSHSNLKQRKLQKIEDKVKRSEQANNQTQKLNDSLQYLDEQIQFLQNKYELFI
SDSETEQKKLIPDKISEIEPEQIENEENTNMMNNVQIEPIYKILDKQEVENTIYYLILFY
DEKLPQWVKQEKLIGYEDEILEYEKQIIQESTELNSKQLLETSIQSIQNENLQIEKDQKQ
EENQFKKVMDQENLEKSKNNFNRNQQFQNDIDEGDFLTDQIQDIEANFMFTYSINWKPRK
DGNIPLNKQVQFVKKITITPQEFIDQILQNKFLN


>TTHERM_00585180(gene)
ATGGAACAATAATAAACAAATTTAGAATACTCTCCTTATATTTTTGAGATTGAGAGCATT
TTGGAAAAGAGAATTCATCCTAAAACAGGAAAAACAGAATTTTTAGTTTAATGGAAATGT
ATATTTTATATTAAAAATTCAAGTATTTATTATTTAAAATAAATTTAATTTAGAATGGCC
AGATGATCCAACATGGGAGCCAGCTTAAAATATCTAAAGCTTTTTAAATAACAATAATTA
AAAGAAAAAGGAAGATGATTCACATTCTAACTTGAAGCAAAGAAAATTGTAAAAAATTGA
AGACAAAGTGAAGAGGTCTGAACAAGCAAATAATCAAACTTAGAAGCTAAATGATAGCTT
GCAATATTTAGATGAATAAATTTAATTTCTTTAAAATAAATACGAGCTTTTTATTTCAGA
TTCAGAGACAGAGTAAAAAAAATTAATTCCTGATAAAATAAGCGAAATTGAACCAGAGTA
AATTGAAAATGAAGAAAATACCAATATGATGAATAACGTTTAAATTGAGCCAATCTATAA
AATATTAGACAAATAAGAAGTTGAAAATACTATTTATTATCTTATTCTCTTTTATGGTAA
TATTTATTTTTGAATTATTTATTGAATTTATTGTTTAATAATTTTAGATGAAAAATTACC
TTAATGGGTGAAGTAAGAAAAGCTGATTGGCTATGAAGATGAAATTTTAGAATATGAAAA
ACAAATAATTTAAGAGAGCACTGAACTAAACTCTAAATAGTTATTAGAAACCAGTATATA
AAGTATACAAAATGAAAATTTATAAATAGAAAAAGATCAAAAATAAGAAGAAAATTAATT
TAAAAAGGTAATGGATCAAGAAAATCTTGAAAAAAGTAAAAATAATTTTAATAGGAATCA
ACAATTTTAAAATGATATAGATGAAGGTGATTTTTTAACAGATTAAATATAAGATATAGA
AGCAAACTTTATGTTTACTTATAGTATTAATTGGAAACCGAGAAAAGATGGAAACATTCC
TCTAAATAAATAAGTCTAATTTGTAAAAAAAATTACAATAACGCCATAAGAATTCATTGA
TTAAATCCTATAAAATAAATTTCTTAATTGA