Identifiers and Description

Gene Model Identifier

TTHERM_01337400

Standard Name

HPL2 (Heterochromatin Protein 1 Like 2)

Aliases

PreTt02558 | 333.m00018 | 3795.m00073 | TCD1 | JUB5

Description

heterochromatin protein 1

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 26.1%

TetraMine Data

TTHERM_01337400

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_21098.16.002203762674495e-72heterochromatin protein 1 (727
aa)
DictyBaseDDB_G02830230.0000000000019997478866288316hcpA on chromosome: 4 position
170065 to 170742
WormBaseWBGene000019950.00000039992052383199455locus:hpl-1 status:Confirmed
UniProt:G5EET5 protein_id
:CAA94152.1
OxytrichaContig19010.0.g640.000000600201742947405Chromo (CHRromatin Organisatio
n MOdifier) domain

General Information

Paragraph NoGene NameParagraph Text
111JUB1,
JUB2,
JUB3,
JUB4,
HPL2,
COI3,
COI6,
COI16,
JUB6
This protein co-localizes with Pdd1p in heterochromatin body in the new macronucleus.

Associated Literature

  1. Ref:26688337: Kataoka K, Mochizuki K (2015) Phosphorylation of an HP1-like Protein Regulates Heterochromatin Body Assembly for DNA Elimination. Developmental cell 35(6):775-88
  2. Ref:25989344: Xu J, Yuan Y, Liang A, Wang W (2015) Chromodomain protein Tcd1 is required for macronuclear genome rearrangement and repair in Tetrahymena. Scientific reports 5( ):10243

Sequences

>TTHERM_01337400(coding)
ATGTTAATTAAATTGAATTTCAGTTTAGTATTTATCACGCTAATTATTAGCTTAGTTATT
GTTTATATTAGCTAAACTCGTAAACTTAATAAATAAAAATTTTTCTTAATTAATTACATA
AATTAAAAAAAACCTTTTGTGTAGATGTTCACTGTAAAGCAACAGGCACTAAATAAAATT
TAAAGTAAGTAGGCTTAACTTCCTAAAAATACATAAGATTCCCTTCAATAAATGCTTGCT
TGGGATTAAGAGTTTCTTGCATCAAAGGATAAGCTGTTTAAAAATAAGCATTAATACTAA
GGGAACGGTGGTTCAGCTTTGCTATTGAATTTAAACACTAACAAAAAGACAAATTTATAA
CAACAGTAACAACAGTAGAATTAAATCTAACCAACATAAATGAGCTAAATTTCGTAACAT
GAACTAAGGTAGTTGTAAAAAAAAAGAAAATTGCAAGAATTAGCAAGAGAAAATAGTAAA
ATTTTAAAGTCATAAAAGTAGCAATAAAAAGAAAATAATGAGTAAATAGATTCATCTTAG
GACGCCTCTGACGAATATGAAGTTGAAAAAATTGTTGATAAAAAAATTGAAAATGGATAA
ATATTTTACAAAGTGAAGTGGAAAGGTTGGGATAGTACTTACAATACTTGGGAACCTGAA
AATAATCTTTTTAGAGTATCTGAAATGATTGAAGAGTACGAAGCTTCAAAAAAATATTAA
AAAAGATAAAATTTCCCAAAATAAGTAGATTCTGGGAGTAGTGATTTGGAAGATAACGAT
AAAAAGTAAAATTCAGCTCCAAAAAAAGGAGAAACTTCAAATTAAATAAATTAAAGTAAC
CTATAAAATAAAAATGAGAGTTTGTCAAAACTTTAGTAGAGTTAGTAAAAAATTTAATCT
AATGTAATAAAAAGTAGATAGCCTTCTAATAATACACCAATAACCCCAAAAGAATAACAA
GATAGACTTTATAAAGAAAATTTAACTGCAAATAAATAGAATAATGCAAAAGAAATGGAT
ACATACGAAAAGAATTAAAATATGAGCAATAGCTAAATTTAACTTGAAAAAAATAAATAA
TTTTATTAATTGCTGATGAATTAAAAATCATAATCTGCTTCTTCTACTTCTGCTTTAATT
CCACCACAAAAACAGAATTAAAAGAATTTAGAAGAAACATAAAATTTGTAAAACAATATA
AAAAATTAAGAAAAAAAGATTGCTAACAACATAGAATAATTAGATCTAGAGGATGATAAT
CTTGAAGTTGAAAAAGATTATTCTTAGTAAATTCATCAAAAGTCACAAAACAAAGAAAAA
TCATTTGAAGAAAATGAAGATGGAAATGAGGACGACAAAGAATACATTTTTGAAGCCATA
CTTGATAAGCGTTAATTAGAGGGATAAGAAGTCGAATATTTGCTGAAATTTTCTAACCAT
GATAAACCTGAGTGGGAACTGATAAGTAATTTAGAAAGCATAGAAGAAGAAATAAAAGAA
TATGAAGAAGGGTTAAAAAGGGCTTAAGAAAAAGCTATTTTGCTATCATAATAAGAAAAT
TTAGATTAATAAAACTTGTAATTTGAAGAGGTTTAATAAGACAAAGAATTTATTAGTTAA
ACTGAACCTGCTACAAGTTTAACAACTATGCAAAGTCTAGTTCATTAAAATAAAGAAAAT
TAATCTTAAGTAAATCATCAGACTAAAAAAAATAAGATTGTCCCTGAATAAATAGATGTG
GACTGCTCAGATGATTAATTTGAACAAGAGGTTTAAAAAAATTAAATGGATATTTAATCT
AATTTAAGCCCATAAAATTCTAACCAAAATATCAATTATTAACCAGACTAATAGAAAAAA
GATAAATAAACTATTGGCTCTGAATTGAATAGTAAATAAAAATAGTAATAATTAAATATC
CAGCAAGTACTTCCTTGCTAAACTAAAATATTAGAAAATGTAATCTAAAATTAATAACCA
TTTAATTTAATTAATCCTTTACTTAATAACACTTCTCTTCAGCAGCTAGCAAATATTTCA
AACCCTATTAATTACACATAAAATTATAACTTTAGCTAGGAAATTGGATGCTTTTATAAA
GGTGATCAAAGATTTTCTATTGAACCTTGTGACTAATCTACTCTACAAGATCTTTCTAAG
ACTACTTTCAAAGTTATGTGGAAACCAAGAGTTAATGGTTGTGTACCTCTACCAAGTCTA
ATATCTTACTAAATGCTAAAAGAACATGATCCAGTAGGCTTGGTTTTATTTTTTGAAAAT
CTAATATAGAAATAATAGTAATAAATAGCTAAATGA


>TTHERM_01337400(protein)
MLIKLNFSLVFITLIISLVIVYISQTRKLNKQKFFLINYINQKKPFVQMFTVKQQALNKI
QSKQAQLPKNTQDSLQQMLAWDQEFLASKDKLFKNKHQYQGNGGSALLLNLNTNKKTNLQ
QQQQQQNQIQPTQMSQISQHELRQLQKKRKLQELARENSKILKSQKQQQKENNEQIDSSQ
DASDEYEVEKIVDKKIENGQIFYKVKWKGWDSTYNTWEPENNLFRVSEMIEEYEASKKYQ
KRQNFPKQVDSGSSDLEDNDKKQNSAPKKGETSNQINQSNLQNKNESLSKLQQSQQKIQS
NVIKSRQPSNNTPITPKEQQDRLYKENLTANKQNNAKEMDTYEKNQNMSNSQIQLEKNKQ
FYQLLMNQKSQSASSTSALIPPQKQNQKNLEETQNLQNNIKNQEKKIANNIEQLDLEDDN
LEVEKDYSQQIHQKSQNKEKSFEENEDGNEDDKEYIFEAILDKRQLEGQEVEYLLKFSNH
DKPEWELISNLESIEEEIKEYEEGLKRAQEKAILLSQQENLDQQNLQFEEVQQDKEFISQ
TEPATSLTTMQSLVHQNKENQSQVNHQTKKNKIVPEQIDVDCSDDQFEQEVQKNQMDIQS
NLSPQNSNQNINYQPDQQKKDKQTIGSELNSKQKQQQLNIQQVLPCQTKILENVIQNQQP
FNLINPLLNNTSLQQLANISNPINYTQNYNFSQEIGCFYKGDQRFSIEPCDQSTLQDLSK
TTFKVMWKPRVNGCVPLPSLISYQMLKEHDPVGLVLFFENLIQKQQQQIAK


>TTHERM_01337400(gene)
ATGTTAATTAAATTGAATTTCAGTTTAGTATTTATCACGCTAATTATTAGCTTAGTTATT
GTTTATATTAGCTAAACTCGTAAACTTAATAAATAAAAATTTTTCTTAATTAATTACATA
AATTAAAAAAAACCTTTTGTGTAGATGTTCACTGTAAAGCAACAGGCACTAAATAAAATT
TAAAGTAAGTAGGCTTAACTTCCTAAAAATACATAAGATTCCCTTCAATAAATGCTTGCT
TGGGATTAAGAGTTTCTTGCATCAAAGGATAAGCTGTTTAAAAATAAGCATTAATACTAA
GGGAACGGTGGTTCAGCTTTGCTATTGAATTTAAACACTAACAAAAAGACAAATTTATAA
CAACAGTAACAACAGTAGAATTAAATCTAACCAACATAAATGAGCTAAATTTCGTAACAT
GAACTAAGGTAGTTGTAAAAAAAAAGAAAATTGCAAGAATTAGCAAGAGAAAATAGTAAA
ATTTTAAAGTCATAAAAGTAGCAATAAAAAGAAAATAATGAGTAAATAGATTCATCTTAG
GACGCCTCTGACGAATATGAAGTTGAAAAAATTGTTGATAAAAAAATTGAAAATGGATAA
ATATTTTACAAAGTGAAGTGGAAAGGTAATTCTCTTTTTAAATTTATTAGGATCAATTAA
TAGATTTAATTTATTTTTTAATTTTAAAAAGGTTGGGATAGTACTTACAATACTTGGGAA
CCTGAAAATAATCTTTTTAGAGTATCTGAAATGATTGAAGAGTACGAAGCTTCAAAAAAA
TATTAAAAAAGATAAAATTTCCCAAAATAAGTAGATTCTGGGAGTAGTGATTTGGAAGAT
AACGATAAAAAGTAAAATTCAGCTCCAAAAAAAGGAGAAACTTCAAATTAAATAAATTAA
AGTAACCTATAAAATAAAAATGAGAGTTTGTCAAAACTTTAGTAGAGTTAGTAAAAAATT
TAATCTAATGTAATAAAAAGTAGATAGCCTTCTAATAATACACCAATAACCCCAAAAGAA
TAACAAGATAGACTTTATAAAGAAAATTTAACTGCAAATAAATAGAATAATGCAAAAGAA
ATGGATACATACGAAAAGAATTAAAATATGAGCAATAGCTAAATTTAACTTGAAAAAAAT
AAATAATTTTATTAATTGCTGATGAATTAAAAATCATAATCTGCTTCTTCTACTTCTGCT
TTAATTCCACCACAAAAACAGAATTAAAAGAATTTAGAAGAAACATAAAATTTGTAAAAC
AATATAAAAAATTAAGGTAAAAAATATAATTAAATTCATGTTTATTTTACCCATTAAATT
TATTAGAAAAAAAGATTGCTAACAACATAGAATAATTAGATCTAGAGGATGATAATCTTG
AAGTTGAAAAAGATTATTCTTAGTAAATTCATCAAAAGTCACAAAACAAAGAAAAATCAT
TTGAAGAAAATGAAGATGGAAATGAGGACGACAAAGAATACATTTTTGAAGCCATACTTG
ATAAGCGTTAATTAGAGGGATAAGAAGTCGAATATTTGCTGAAATTTTCTAGTAAATTTA
CTTAGCTTAATTAAGTTGTTTTTATTTTCTTTTAAAAAAATAGACCATGATAAACCTGAG
TGGGAACTGATAAGTAATTTAGAAAGCATAGAAGAAGAAATAAAAGAATATGAAGAAGGG
TTAAAAAGGGCTTAAGAAAAAGCTATTTTGCTATCATAATAAGAAAATTTAGATTAATAA
AACTTGTAATTTGAAGAGGTTTAATAAGACAAAGAATTTATTAGTTAAACTGAACCTGCT
ACAAGTTTAACAACTATGCAAAGTCTAGTTCATTAAAATAAAGAAAATTAATCTTAAGTA
AATCATCAGACTAAAAAAAATAAGATTGTCCCTGAATAAATAGATGTGGACTGCTCAGAT
GATTAATTTGAACAAGAGGTTTAAAAAAATTAAATGGATATTTAATCTAATTTAAGCCCA
TAAAATTCTAACCAAAATATCAATTATTAACCAGACTAATAGAAAAAAGATAAATAAACT
ATTGGCTCTGAATTGAATAGTAAATAAAAATAGTAATAATTAAATATCCAGCAAGTACTT
CCTTGCTAAACTAAAATATTAGAAAATGTAATCTAAAATTAATAACCATTTAATTTAATT
AATCCTTTACTTAATAACACTTCTCTTCAGCAGCTAGCAAATATTTCAAACCCTATTAAT
TACACATAAAATTATAACTTTAGCTAGGAAATTGGATGCTTTTATAAAGGTGATCAAAGA
TTTTCTATTGAACCTTGTGACTAATCTACTCTACAAGATCTTTCTAAGACTACTTTCAAA
GTTATGTGGAAACCAAGAGTTAATGGTTGTGTACCTCTACCAAGTCTAATATCTTACTAA
ATGCTAAAAGAACATGATCCAGTAGGCTTGGTTTTATTTTTTGAAAATCTAATATAGAAA
TAATAGTAATAAATAGCTAAATGA